Glyma19g32320 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g32320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g32320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g32320

Feature Type:	gene_model
Chromosome:	Gm19
Start:	40081904
stop:	40082412
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g32320

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G59900	AT	Annotation by Michelle Graham. TAIR10: pyruvate dehydrogenase complex E1 alpha subunit \| chr1:22051368-22053660 FORWARD LENGTH=389	SoyBase	E_val: 1.00E-73	ISS
GO:0006096	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycolysis	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0043231	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular membrane-bounded organelle	SoyBase	N/A	ISS
GO:0004739	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pyruvate dehydrogenase (acetyl-transferring) activity	SoyBase	N/A	ISS
GO:0016624	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor	SoyBase	N/A	ISS
PTHR11516	Panther	PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA SUBUNIT (BACTERIAL AND ORGANELLAR)	JGI		ISS
PTHR11516:SF4	Panther	PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA SUBUNIT	JGI		ISS
PF00676	PFAM	Dehydrogenase E1 component	JGI		ISS
UniRef100_D2D323	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Pyruvate dehydrogenase alpha subunit n=1 Tax=Gossypium hirsutum RepID=D2D323_GOSHI	SoyBase	E_val: 8.00E-75	ISS
UniRef100_I1JBV5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JBV5_SOYBN	SoyBase	E_val: 5.00E-79	ISS

Expression Patterns of Glyma19g32320

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g32320 not represented in the dataset	Glyma19g32320 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g32320 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g141500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g32320

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g32320

Limit To All Plant Sequences

>Glyma19g32320.1   sequence type=CDS   gene model=Glyma19g32320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCGCGCACCTTCTCCTCGGAGCTCCTCACCTTCTTCCGTGATATGGCCCTGATGCGGCGCATGAAGATTGCCGCGGACTCCCTCTACAAGGCCAAGCTCATCCGCGGCTTTTGCCACCTCTACGACGGCCAGGAGGCCGTCGCCGTCGGCATGGAGGCCGCTTCACAAAAATGGACTCCATCATCACCGCCTACTGCGACCACTGCACCTTCCTCGGCCGCGGCGGTCTTCGCCGAGCTCATGGGCTGCAGGGATGGGTGCTCGAAGGGGAAGGGTGGTTCCATTGATTTTTACAAGGAGAGTGGGTTCTACGGTGGGCATGGGATTGTTGGGGCGCAGGTTCCGTTGCGGTGTGGGTTGGCGTTTGCGCAGAAGTACTCCAAGGATGAGAGTGTCACTTTTGCTATGTATGGAGATGGTGCTGCCAATCAGGGACAGCTCTTTGAGGAGGCGCTTAACATTGCTGCACTTTGGGATCTTCCTGCTATTTTG

Predicted protein sequences of Glyma19g32320

Limit To All Plant Sequences

>Glyma19g32320.1   sequence type=predicted peptide   gene model=Glyma19g32320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPRTFSSELLTFFRDMALMRRMKIAADSLYKAKLIRGFCHLYDGQEAVAVGMEAASQKWTPSSPPTATTAPSSAAAVFAELMGCRDGCSKGKGGSIDFYKESGFYGGHGIVGAQVPLRCGLAFAQKYSKDESVTFAMYGDGAANQGQLFEEALNIAALWDLPAIL

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain