Report for Sequence Feature Glyma19g32040
Feature Type: gene_model
Chromosome: Gm19
Start: 39827470
stop: 39828612
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g32040
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G41750 AT
Annotation by Michelle Graham. TAIR10: DTW domain-containing protein | chr2:17421746-17422507 REVERSE LENGTH=253
SoyBase E_val: 2.00E-29 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PTHR21392 Panther
UNCHARACTERIZED
JGI ISS
PF03942 PFAM
DTW domain
JGI ISS
UniRef100_D7LHB1 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: DTW domain-containing protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LHB1_ARALL
SoyBase E_val: 5.00E-28 ISS
UniRef100_I1N903 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N903_SOYBN
SoyBase E_val: 4.00E-63 ISS
Expression Patterns of Glyma19g32040
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma19g32040
Paralog Evidence Comments
Glyma03g29301 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma19g32040 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g139000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g32040
Coding sequences of Glyma19g32040
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g32040.1 sequence type=CDS gene model=Glyma19g32040 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTGAGCGCCAGCGAGGAGTTCCTTAATGAGTTCGCAACTAGGGTTTGTTTGAGCGTGGATGAGAGTGCGAGTGGCGGGAGCATTTACGATTCCGAGTTGATTTATTGGAAGGAGCCTTTTTCTGGGTGCGTGAGTACCATGGAGGCGGTGGCGAGGGCACTATGCGTGCTCGAGCCCAATGGGCTCGAGACTGAAGAGATGTTGATTGGGGTTTTGAGGGAAATGGTGAGGTTGCAGGCCGGGTTTTTGAAGCCTGTGAAGTCCAGGGCCCAAGTTGTTGAAGAAGAAGGCTGA
Predicted protein sequences of Glyma19g32040
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g32040.1 sequence type=predicted peptide gene model=Glyma19g32040 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVSASEEFLNEFATRVCLSVDESASGGSIYDSELIYWKEPFSGCVSTMEAVARALCVLEPNGLETEEMLIGVLREMVRLQAGFLKPVKSRAQVVEEEG*