SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma19g32040

Feature Type:gene_model
Chromosome:Gm19
Start:39827470
stop:39828612
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G41750AT Annotation by Michelle Graham. TAIR10: DTW domain-containing protein | chr2:17421746-17422507 REVERSE LENGTH=253 SoyBaseE_val: 2.00E-29ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR21392Panther UNCHARACTERIZED JGI ISS
PF03942PFAM DTW domain JGI ISS
UniRef100_D7LHB1UniRef Annotation by Michelle Graham. Most informative UniRef hit: DTW domain-containing protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LHB1_ARALL SoyBaseE_val: 5.00E-28ISS
UniRef100_I1N903UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N903_SOYBN SoyBaseE_val: 4.00E-63ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma03g29301 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g139000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g32040.1   sequence type=CDS   gene model=Glyma19g32040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAGCGCCAGCGAGGAGTTCCTTAATGAGTTCGCAACTAGGGTTTGTTTGAGCGTGGATGAGAGTGCGAGTGGCGGGAGCATTTACGATTCCGAGTTGATTTATTGGAAGGAGCCTTTTTCTGGGTGCGTGAGTACCATGGAGGCGGTGGCGAGGGCACTATGCGTGCTCGAGCCCAATGGGCTCGAGACTGAAGAGATGTTGATTGGGGTTTTGAGGGAAATGGTGAGGTTGCAGGCCGGGTTTTTGAAGCCTGTGAAGTCCAGGGCCCAAGTTGTTGAAGAAGAAGGCTGA

>Glyma19g32040.1   sequence type=predicted peptide   gene model=Glyma19g32040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVSASEEFLNEFATRVCLSVDESASGGSIYDSELIYWKEPFSGCVSTMEAVARALCVLEPNGLETEEMLIGVLREMVRLQAGFLKPVKSRAQVVEEEG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo