|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G49760 | AT | Annotation by Michelle Graham. TAIR10: poly(A) binding protein 8 | chr1:18416740-18419753 FORWARD LENGTH=671 | SoyBase | E_val: 1.00E-25 | ISS |
| GO:0006164 | GO-bp | Annotation by Michelle Graham. GO Biological Process: purine nucleotide biosynthetic process | SoyBase | N/A | ISS |
| GO:0046686 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cadmium ion | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0003723 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding | SoyBase | N/A | ISS |
| GO:0003743 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| PTHR24011 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR24011:SF69 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| UniRef100_G7JK09 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Poly(A)-binding protein n=1 Tax=Medicago truncatula RepID=G7JK09_MEDTR | SoyBase | E_val: 8.00E-31 | ISS |
| UniRef100_I1MXM6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MXM6_SOYBN | SoyBase | E_val: 9.00E-33 | ISS |
|
Glyma19g31370 not represented in the dataset |
Glyma19g31370 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g31370.1 sequence type=CDS gene model=Glyma19g31370 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high TCAAATTCTACTTGGGGTACAAAGGATAGTGCAATTGATGATAGCAAGTGGCTTCTTTTTTTTTTTTTTTATCCATCAAAGTCAATAAACCGAGCAAAAGCGGCGAGATGGTGCAGCATCAGAGTCCGGTGTCGTTCACTCGGTTATGGCTATGCCGCGTGGGCATTGGATGTGCTGAATTTCACTCCACTTAACAACAGACCTATTGGGATCATGTATTCTCATTGGGATCCTAGTCTTAGGAAGAGTGGTACTACGAATACTTTTATCAAGAATTTGGATAAGGCTATTTACCACATGGCCTTACATGATACTTTTTCTACTTTTGGACTCATTCTTTCTTGCAAA
>Glyma19g31370.1 sequence type=predicted peptide gene model=Glyma19g31370 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high SNSTWGTKDSAIDDSKWLLFFFFYPSKSINRAKAARWCSIRVRCRSLGYGYAAWALDVLNFTPLNNRPIGIMYSHWDPSLRKSGTTNTFIKNLDKAIYHMALHDTFSTFGLILSCK
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||