SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g31100

Feature Type:gene_model
Chromosome:Gm19
Start:38839437
stop:38841559
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g31100
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G41200AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 26 Blast hits to 26 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 26; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:17171657-17172929 FORWARD LENGTH=161 SoyBaseE_val: 5.00E-27ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6SWB5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWB5_SOYBN SoyBaseE_val: 2.00E-110ISS
UniRef100_O80667UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Arabidopsis thaliana RepID=O80667_ARATH SoyBaseE_val: 2.00E-24ISS

Expression Patterns of Glyma19g31100
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g31100
ParalogEvidenceComments
Glyma03g28381 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g31100 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g130600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g31100
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g31100
>Glyma19g31100.1   sequence type=CDS   gene model=Glyma19g31100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCCTATCTCTGCCGAAACTTGCACCTGGTGCTGACAAAAAAAAGCACGAAGAACTTGTCCCAATTATAGAGGAAATCTATAAAGAGAAAGTCAAAAACGCCAAAGAGTTTTCAGAATTCTACCATGCAGTATGCGAGATAGTCGAGCAACTCAATGAAAAGCTTGGAAACACGCAGATCAAACTCCCAGAGACAAAGGCTATTGAGAAGGAGTACAGGAAGCGTCGTGGAGATAATGACACTGACAAAAAGCCACTGACAAAAGCAGAATTCCAGGAGATCATGCAAAATTTGGTGAAGACATCAGGATTCACTGGTATAGGAGCAAAGGAAGCAATCTTGTGCATCTTTGGTGTTCCATTGGCTGCTCTGTTCATAAAGCAAAGAGTGATGCCTGAGGCAGTTCGTGATGAGTTCTTCATCCCAGGAGTAACTTCTGCAACGGTTTTCACCCTTGCTGCTCTTAACAAGATTTGA
Predicted protein sequences of Glyma19g31100
>Glyma19g31100.1   sequence type=predicted peptide   gene model=Glyma19g31100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLSLPKLAPGADKKKHEELVPIIEEIYKEKVKNAKEFSEFYHAVCEIVEQLNEKLGNTQIKLPETKAIEKEYRKRRGDNDTDKKPLTKAEFQEIMQNLVKTSGFTGIGAKEAILCIFGVPLAALFIKQRVMPEAVRDEFFIPGVTSATVFTLAALNKI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo