Glyma19g30760 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g30760

Feature Type:	gene_model
Chromosome:	Gm19
Start:	38404227
stop:	38404909
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Expression Patterns of Glyma19g30760

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g30760 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g127600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g30760

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g30760

Limit To All Plant Sequences

>Glyma19g30760.1   sequence type=CDS   gene model=Glyma19g30760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTCTTGAAATTCACTCCATCCAACAACACATGCATCCTCCTCTCCTTCCTCTTTCAAGTCCAACCAATTAATGTTGCTTACCAACTCCTCCATTTTGCCTTGGACCCGTCAAACTTCAACTTGCTCCACTTCTTAATCTCTACCTTTATAGCAACTTTAGTTTCTCCTTGA

Predicted protein sequences of Glyma19g30760

Limit To All Plant Sequences

>Glyma19g30760.1   sequence type=predicted peptide   gene model=Glyma19g30760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVLKFTPSNNTCILLSFLFQVQPINVAYQLLHFALDPSNFNLLHFLISTFIATLVSP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain