SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma19g30621

Feature Type:gene_model
Chromosome:Gm19
Start:38241932
stop:38243050
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G80770AT Annotation by Michelle Graham. TAIR10: P-loop containing nucleoside triphosphate hydrolases superfamily protein | chr1:30355717-30357786 FORWARD LENGTH=355 SoyBaseE_val: 1.00E-22ISS
GO:0015684GO-bp Annotation by Michelle Graham. GO Biological Process: ferrous iron transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
GO:0015093GO-mf Annotation by Michelle Graham. GO Molecular Function: ferrous iron transmembrane transporter activity SoyBaseN/AISS
UniRef100_D7KWN1UniRef Annotation by Michelle Graham. Most informative UniRef hit: PDE318 (Fragment) n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KWN1_ARALL SoyBaseE_val: 3.00E-20ISS
UniRef100_I1KYV4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KYV4_SOYBN SoyBaseE_val: 7.00E-28ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g30621 not represented in the dataset

Glyma19g30621 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g126200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g30621.1   sequence type=CDS   gene model=Glyma19g30621   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGGGGCTTAAGAAAATTGAAGAGATTTTTGCTCAAGAATGGAAAGTTGTTGATGATTTGTTAGGCATAGCCAAGAAACTCAATTTATATCATCTAGCTGATAATTATAAATCTCTTAATGTAGGCAAATCTTCTTTGGTCCATGTATTCTCTACTGGCAAGCCTGAGATTTCTAACTATCCCTTCACAACAAGAGGAATTCTTATGGGTCATATTATTTTAAACTTTTAG

>Glyma19g30621.1   sequence type=predicted peptide   gene model=Glyma19g30621   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLGLKKIEEIFAQEWKVVDDLLGIAKKLNLYHLADNYKSLNVGKSSLVHVFSTGKPEISNYPFTTRGILMGHIILNF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo