Glyma19g30480 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g30480

Feature Type:	gene_model
Chromosome:	Gm19
Start:	38081927
stop:	38086641
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g30480

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G68070	AT	Annotation by Michelle Graham. TAIR10: Zinc finger, C3HC4 type (RING finger) family protein \| chr1:25515412-25516767 REVERSE LENGTH=343	SoyBase	E_val: 1.00E-86	ISS
GO:0006661	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR11203	Panther	CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR	JGI		ISS
PTHR11203:SF27	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00097	PFAM	Zinc finger, C3HC4 type (RING finger)	JGI		ISS
UniRef100_G7L4S3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: E3 ubiquitin-protein ligase n=1 Tax=Medicago truncatula RepID=G7L4S3_MEDTR	SoyBase	E_val: 4.00E-163	ISS
UniRef100_UPI0001BA38A7	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0001BA38A7 related cluster n=1 Tax=unknown RepID=UPI0001BA38A7	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma19g30480

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g30480

Paralog	Evidence	Comments
Glyma03g27500	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g30480 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g124800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g30480

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g30480

Limit To All Plant Sequences

>Glyma19g30480.2   sequence type=CDS   gene model=Glyma19g30480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACCAACAGCAGCGCCACGTCAGCAGCGGAACTACTAATCCTGTGGCCGTGCTCCGCTTCTCCACGGGGCGCGCCTTCCCCTTCGCACGCCTCATCGCCGCCTCCCGCCGCCGCCTATTCCTCTCCGACTGCGCCGACCACCGATCGGACGACGACGGAGACAGCGACGCCGACGCCGGCGAGTGCGCGTACTCGCGCGCGGTGCTGGTGCTCGACATGGTGTGGAACCTCGCCTTCGTCGTCGCCGCCGCCGGCGTCCTCCTCTCCACGCTCCGAGAGCGGCCAGCGACGCCGCTGAGGCTCTGGCTCTGCGGCTACGCCTTCGAGTGCGTCCTTCACATGGCGTTCGTGTACTTCGAATTCCGAACCAGAATTCGCGATTCCTTCTCTCACACTACCTATAGCATTGTGAAGAAGCTAGAGCCTATGAACACTCTGGCATCATCTGTTTGGTGGGTGTTTGGATTTTATTGGATTGTTGTGGGTGGCCAAGCACTTTTGGAAGATTCTCCACATCTCTACTGGTTAACAGTGGTCTTTCTAGCCTTTGACGTATTTTTTATTATCTTTTGCATTGGGATGGCATGTATAGTTTTCTTTGCTCTCTTCTGCATCATCCCAATAATAGCATTAGCTTATGCTATGAGAATCAGAGAAGGTGCATCAGAAGAAGATATCAGGTCACTTCCTATGTATAGGTTTAGCCTGTCAAATTCATTGGTGATGGTTGATGACAACAAGAAGCAACTTGTTAAAGTAAGAGTAGATTCATGCAATGGAAGCCATATGAGTGAACTTTCTCTCCATCCAGATGATTCTGAATGCTGTATCTGTCTGTGTCCATATGTTGAAGGAGAAGAACTGTATCGCCTTCCCTGTACACACCATTTTCATTGTGGATGCATCAGCCGTTGGCTTCGGACAAAAGCTACTTGCCCGCTGTGCAAATTTAATATCCTTAGAGGTGATACATTGGTTTGA

Predicted protein sequences of Glyma19g30480

Limit To All Plant Sequences

>Glyma19g30480.2   sequence type=predicted peptide   gene model=Glyma19g30480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDQQQRHVSSGTTNPVAVLRFSTGRAFPFARLIAASRRRLFLSDCADHRSDDDGDSDADAGECAYSRAVLVLDMVWNLAFVVAAAGVLLSTLRERPATPLRLWLCGYAFECVLHMAFVYFEFRTRIRDSFSHTTYSIVKKLEPMNTLASSVWWVFGFYWIVVGGQALLEDSPHLYWLTVVFLAFDVFFIIFCIGMACIVFFALFCIIPIIALAYAMRIREGASEEDIRSLPMYRFSLSNSLVMVDDNKKQLVKVRVDSCNGSHMSELSLHPDDSECCICLCPYVEGEELYRLPCTHHFHCGCISRWLRTKATCPLCKFNILRGDTLV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain