Glyma19g30140 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g30140): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g30140): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g30140

Feature Type:	gene_model
Chromosome:	Gm19
Start:	37805394
stop:	37807412
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g30140

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G43810	AT	Annotation by Michelle Graham. TAIR10: calmodulin 7 \| chr3:15664619-15666355 REVERSE LENGTH=149	SoyBase	E_val: 1.00E-103	ISS
GO:0005513	GO-bp	Annotation by Michelle Graham. GO Biological Process: detection of calcium ion	SoyBase	N/A	ISS
GO:0006084	GO-bp	Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process	SoyBase	N/A	ISS
GO:0009612	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to mechanical stimulus	SoyBase	N/A	ISS
GO:0010099	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of photomorphogenesis	SoyBase	N/A	ISS
GO:0019722	GO-bp	Annotation by Michelle Graham. GO Biological Process: calcium-mediated signaling	SoyBase	N/A	ISS
GO:0019932	GO-bp	Annotation by Michelle Graham. GO Biological Process: second-messenger-mediated signaling	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005509	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calcium ion binding	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
KOG0027	KOG	Calmodulin and related proteins (EF-Hand superfamily)	JGI		ISS
PTHR23050	Panther	CALCIUM BINDING PROTEIN	JGI		ISS
PTHR23050:SF20	Panther	CALMODULIN	JGI		ISS
PF00036	PFAM	EF hand	JGI		ISS
UniRef100_I1N8I7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N8I7_SOYBN	SoyBase	E_val: 2.00E-102	ISS
UniRef100_P17928	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Calmodulin n=7 Tax=Magnoliophyta RepID=CALM_MEDSA	SoyBase	E_val: 1.00E-101	ISS

Expression Patterns of Glyma19g30140

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g30140 not represented in the dataset	Glyma19g30140 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g30140 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g121900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g30140

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g30140

Limit To All Plant Sequences

>Glyma19g30140.1   sequence type=CDS   gene model=Glyma19g30140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAATCAACTCACCGATGAACAGATCTCTGAGTTCAAGGAAGCCTTCAGTTTGTTCGATAAGGATGGAGATGGTTGCATCACAACAAAGGAGCTTGGGACCGTTATGCGTTCGTTGGGTCAGAACCCAACAGAGGCTGAGCTCCAAGACATGATCAACGAAGTAGATGCTGATGGCAATGGCACCATTGACTTCCCCGAGTTCTTGAACCTCATGGCCAGAAAGATGAAGGACACTGATTCTGAGGAGGAGCTGAAGGAGGCGTTCAGAGTGTTTGACAAGGACCAGAATGGGTTCATTTCTGCTGCTGAACTCCGCCATGTGATGACCAACCTCGGGGAGAAGCTCACTGATGAAGAGGTTGATGAGATGATTCGAGAGGCTGATGTTGATGGCGACGGCCAAATAAACTACGAGGAGTTTGTTAAGGTCATGATGGCCAAGTGA

Predicted protein sequences of Glyma19g30140

Limit To All Plant Sequences

>Glyma19g30140.1   sequence type=predicted peptide   gene model=Glyma19g30140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain