SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g29720): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g29720): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g29720

Feature Type:gene_model
Chromosome:Gm19
Start:37451123
stop:37455929
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G17770AT Annotation by Michelle Graham. TAIR10: NADH:cytochrome B5 reductase 1 | chr5:5864543-5866495 REVERSE LENGTH=281 SoyBaseE_val: 1.00E-168ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0022900GO-bp Annotation by Michelle Graham. GO Biological Process: electron transport chain SoyBaseN/AISS
GO:0042732GO-bp Annotation by Michelle Graham. GO Biological Process: D-xylose metabolic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0004128GO-mf Annotation by Michelle Graham. GO Molecular Function: cytochrome-b5 reductase activity, acting on NAD(P)H SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
KOG0534 KOG NADH-cytochrome b-5 reductase JGI ISS
PTHR19370Panther NADH-CYTOCHROME B5 REDUCTASE JGI ISS
PTHR19370:SF8Panther SUBFAMILY NOT NAMED JGI ISS
PF00175PFAM Oxidoreductase NAD-binding domain JGI ISS
PF00970PFAM Oxidoreductase FAD-binding domain JGI ISS
UniRef100_Q5PY86UniRef Annotation by Michelle Graham. Most informative UniRef hit: NADH:cytochrome b5 reductase n=1 Tax=Vernicia fordii RepID=Q5PY86_VERFO SoyBaseE_val: 0ISS
UniRef100_UPI0001D62E83UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001D62E83 related cluster n=1 Tax=unknown RepID=UPI0001D62E83 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g29720 not represented in the dataset

Glyma19g29720 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma03g00920 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g119000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g29720.1   sequence type=CDS   gene model=Glyma19g29720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTTCTTGCAAGCACCAGAAAATCAGATACTTGTGGGTGTGGCCGTGGCCGTTGTAGCCATTGGGCTTGGTGCTGTCTATCTCTATTCATCTAAGAAGCGCAAAGGTTGCTTGGACCCATTGAACTTTAAGGTGTTCAAACTTGTTAAGCGTGCACAGCTGAGCCATAATGTTGCTAAGTTCACATTTGCACTTCCAACACCTACATCTGTTTTGGGTCTTCCAATTGGGCAACACATAAGTTGCAGGGGTAAAGATGCTCAAGGTGAAGACGTTATCAAACCATATACCCCTACTACATTGGATTCCGATGTTGGACATTTTGAACTAGTTATTAAGATGTACCCACAAGGAAGGATGTCACACCATTTCCGTGAGATGCGTGTTGGTGACTACCTTTCTGTGAAAGGACCCAAGGGACGTTTCAAGTACCAACCTGGCGAGGTTAGGGCATTTGGGATGCTTGCTGGAGGCTCTGGAATCACCCCAATGTTTCAAGTTGCTAGAGCTATATTAGAAAACCCTAATGACAGGACCAAAGTACATCTTATCTATGCCAATGTTACGTATGAGGACATTCTTTTGAAGGAAGAGCTTGATGGTCTTGCTTCTAACTATCCAGATCGATTCAAAATATACTATGTGTTAAATCAGCCTCCTGAGGTATGGGATGGTGGTGAAGGATTTGTGTCAAAGGAGATGATTCAAACACATTGCCCTGCTCCAGCACAAGATATTAAGATATTGAGATGTGGCCCCCCACCTATGAACAAGGCCATGGCTGCTCACCTTGAAGCCCTTGGATATGCTCCTGAGATGCAGTTCCAGTTCTGA

>Glyma19g29720.1   sequence type=predicted peptide   gene model=Glyma19g29720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDFLQAPENQILVGVAVAVVAIGLGAVYLYSSKKRKGCLDPLNFKVFKLVKRAQLSHNVAKFTFALPTPTSVLGLPIGQHISCRGKDAQGEDVIKPYTPTTLDSDVGHFELVIKMYPQGRMSHHFREMRVGDYLSVKGPKGRFKYQPGEVRAFGMLAGGSGITPMFQVARAILENPNDRTKVHLIYANVTYEDILLKEELDGLASNYPDRFKIYYVLNQPPEVWDGGEGFVSKEMIQTHCPAPAQDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo