SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma19g29700

Feature Type:gene_model
Chromosome:Gm19
Start:37432368
stop:37436871
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G03240AT Annotation by Michelle Graham. TAIR10: frataxin homolog | chr4:1423685-1424758 REVERSE LENGTH=187 SoyBaseE_val: 1.00E-62ISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0009060GO-bp Annotation by Michelle Graham. GO Biological Process: aerobic respiration SoyBaseN/AISS
GO:0009790GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0048825GO-bp Annotation by Michelle Graham. GO Biological Process: cotyledon development SoyBaseN/AISS
GO:0051301GO-bp Annotation by Michelle Graham. GO Biological Process: cell division SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0004322GO-mf Annotation by Michelle Graham. GO Molecular Function: ferroxidase activity SoyBaseN/AISS
KOG3413 KOG Mitochondrial matrix protein frataxin, involved in Fe/S protein biosynthesis JGI ISS
PTHR16821Panther FRATAXIN JGI ISS
PF01491PFAM Frataxin-like domain JGI ISS
UniRef100_G7KHT5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Frataxin-like protein n=2 Tax=Medicago truncatula RepID=G7KHT5_MEDTR SoyBaseE_val: 6.00E-83ISS
UniRef100_I1N8F6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N8F6_SOYBN SoyBaseE_val: 8.00E-137ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma03g00960 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g118800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g29700.1   sequence type=CDS   gene model=Glyma19g29700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTCAAAGCTGCTTTTGAAGAGAAGGCTCTTTAGGTTTTTGCAACTGTCACAACCTTCTTTTTCTTCCATTCATGCAGCCCCAATCCTTTCTGTAAAAGCTTCAGAATTCATGTTCCCCTACAAGGAGAATGCCCTTCTTCCTCCTCTCTCTTCTTCTTCTAGAAACTTCTGCTCTCGCAGTTTTAATCTTGATGAATCTCAAGGCCCCCTGACTATTGATTACAGTTCTCTACTGCAGGAGGGTGAATTCCACAGACTGGCTGATTCCACAATACATAGCCTCCAAGAGAAATTAGAGGACTATGGAGACTCAGTTGAAGTTGATGGATTTGACATAGACTACGGCAATGATGTTTTGACTATAAAACTTGGCGATCTTGGCACCTATGTATTGAACAAACAAACACCAAATAGACAACTTTGGCTGTCTTCTCCAGTGAGTGGTCCTTCAAGGTTTGATTGGGATCGGGATACTAAAGCTTGGATTTATAGGCGGAACAAAGCAAACTTGTATAAAATTTTGGAAGGCGAGTTTGAGCAGTTATGTGGCAAACCTATTGATCTTTCCTAA

>Glyma19g29700.1   sequence type=predicted peptide   gene model=Glyma19g29700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASKLLLKRRLFRFLQLSQPSFSSIHAAPILSVKASEFMFPYKENALLPPLSSSSRNFCSRSFNLDESQGPLTIDYSSLLQEGEFHRLADSTIHSLQEKLEDYGDSVEVDGFDIDYGNDVLTIKLGDLGTYVLNKQTPNRQLWLSSPVSGPSRFDWDRDTKAWIYRRNKANLYKILEGEFEQLCGKPIDLS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo