SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g29621

Feature Type:gene_model
Chromosome:Gm19
Start:37323550
stop:37324242
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g29621
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G26010AT Annotation by Michelle Graham. TAIR10: Peroxidase superfamily protein | chr4:13200653-13201688 FORWARD LENGTH=310 SoyBaseE_val: 7.00E-51ISS
GO:0006826GO-bp Annotation by Michelle Graham. GO Biological Process: iron ion transport SoyBaseN/AISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0010054GO-bp Annotation by Michelle Graham. GO Biological Process: trichoblast differentiation SoyBaseN/AISS
GO:0010106GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0004601GO-mf Annotation by Michelle Graham. GO Molecular Function: peroxidase activity SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
PF00141PFAM Peroxidase JGI ISS
UniRef100_A2Q4B7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Haem peroxidase, plant/fungal/bacterial n=1 Tax=Medicago truncatula RepID=A2Q4B7_MEDTR SoyBaseE_val: 3.00E-65ISS
UniRef100_I1JK64UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JK64_SOYBN SoyBaseE_val: 4.00E-85ISS

Expression Patterns of Glyma19g29621
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g29621 not represented in the dataset
Glyma19g29621 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g29621
ParalogEvidenceComments
Glyma03g01020 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g29621 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g118100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g29621
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g29621
>Glyma19g29621.1   sequence type=CDS   gene model=Glyma19g29621   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGAGAAAGATTCCGGCACCAACGACAGCGTTCGGGGCTACAACCTCATCGACGAAGCGAAGAAAACCCTCGAGGCAGCATCAACCAGAGACACCGTGGCCTTATCAAGAGGACCCAAATACAACCTTTGGACGGGAAGACGCGACAGATTAGTATCCAACATCAACGACGTCAACATTCCAGGATCTGACAGTCCTGTGTCCGTAACATTACAATTCTTCGCGAGTAAAGGCATAACAAAACAGGAAATGGTGACCCTTTTCAGAGCACACACCGTTGGTGTTGCACATTGTATTCTTTTGTTTTTTGAGTTTTATAAGGAGATTCTTGCGAAGAAAGGATTGCTGCAGATTGATCAGCAGCTTGCATTGGATGCGGGTACCAAAGGGTTTGTATTGGATTTCGCTTCGAATGGTGATAAGTTCCAAAAGGGTTTTGCGAATGCGATTGTAAAGATGGGGGAGATTGATGTTCTGGTTGGGAATCAAGGTGAAATTCGTAAGAAATGCTCGGTTTTCAACCGCAACTAG
Predicted protein sequences of Glyma19g29621
>Glyma19g29621.1   sequence type=predicted peptide   gene model=Glyma19g29621   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEKDSGTNDSVRGYNLIDEAKKTLEAASTRDTVALSRGPKYNLWTGRRDRLVSNINDVNIPGSDSPVSVTLQFFASKGITKQEMVTLFRAHTVGVAHCILLFFEFYKEILAKKGLLQIDQQLALDAGTKGFVLDFASNGDKFQKGFANAIVKMGEIDVLVGNQGEIRKKCSVFNRN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo