SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g28574

Feature Type:gene_model
Chromosome:Gm19
Start:36159028
stop:36159273
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g28574
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG00140AT Annotation by Michelle Graham. TAIR10: ATP synthase subunit C family protein | chrC:13262-13507 REVERSE LENGTH=81 SoyBaseE_val: 1.00E-31ISS
GO:0006091GO-bp Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy SoyBaseN/AISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0015986GO-bp Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled proton transport SoyBaseN/AISS
GO:0015991GO-bp Annotation by Michelle Graham. GO Biological Process: ATP hydrolysis coupled proton transport SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0033177GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting two-sector ATPase complex, proton-transporting domain SoyBaseN/AISS
GO:0045263GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting ATP synthase complex, coupling factor F(o) SoyBaseN/AISS
GO:0015078GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transmembrane transporter activity SoyBaseN/AISS
PF00137PFAM ATP synthase subunit C JGI ISS
UniRef100_Q8RU61UniRef Annotation by Michelle Graham. Best UniRef hit: ATP synthase subunit c, chloroplastic n=1 Tax=Atropa belladonna RepID=ATPH_ATRBE SoyBaseE_val: 6.00E-30ISS
UniRef100_Q8RU61UniRef Annotation by Michelle Graham. Most informative UniRef hit: ATP synthase subunit c, chloroplastic n=1 Tax=Atropa belladonna RepID=ATPH_ATRBE SoyBaseE_val: 6.00E-30ISS

Expression Patterns of Glyma19g28574
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g28574 not represented in the dataset
Glyma19g28574 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g28574 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g109600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g28574
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g28574
>Glyma19g28574.1   sequence type=CDS   gene model=Glyma19g28574   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATCTAATTATTTTTGCTGCTTTTGTTATTGCTGCTGGATTGACCGTAGGACTTGCTTCTATTGGACCTGGGGTTGAAGGGATTGCACGACAACCAAAGACAAAGGGAAAAATACGAGGTACTTTATTGCTTAGTTTGGTTTTTATGGAAGCTTTAACAATTTATGGACTGGTTGTAGCATTAACACTTTTATTTGCTAATCCTTTTGTTTAA
Predicted protein sequences of Glyma19g28574
>Glyma19g28574.1   sequence type=predicted peptide   gene model=Glyma19g28574   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNLIIFAAFVIAAGLTVGLASIGPGVEGIARQPKTKGKIRGTLLLSLVFMEALTIYGLVVALTLLFANPFV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo