SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g28550): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g28550): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g28550

Feature Type:gene_model
Chromosome:Gm19
Start:36085224
stop:36087778
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G08570AT Annotation by Michelle Graham. TAIR10: atypical CYS HIS rich thioredoxin 4 | chr1:2713059-2714312 FORWARD LENGTH=275 SoyBaseE_val: 7.00E-111ISS
GO:0006662GO-bp Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process SoyBaseN/AISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0031969GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast membrane SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0015035GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity SoyBaseN/AISS
GO:0016671GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor SoyBaseN/AISS
KOG0907 KOG Thioredoxin JGI ISS
PTHR10438Panther THIOREDOXIN-RELATED JGI ISS
PTHR10438:SF7Panther THIOREDOXIN JGI ISS
PF00085PFAM Thioredoxin JGI ISS
UniRef100_A2Q5R3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thioredoxin domain 2; Thioredoxin fold n=1 Tax=Medicago truncatula RepID=A2Q5R3_MEDTR SoyBaseE_val: 1.00E-141ISS
UniRef100_I1N864UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1N864_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g28550 not represented in the dataset

Glyma19g28550 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma16g04700 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g109400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g28550.1   sequence type=CDS   gene model=Glyma19g28550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGAGGTTTTGACCAAGGCGAGTTTGGTTTCCTCTTCTTCTTCCTCATGGCATGGGGTTGGTCAACGGCATCATCGAAGGGTTTCAACGGTTTCCAACACTTGTAGCTTCGGTTCTGGCGTGGGAAAGTTCTCTTCTTTGAAGATGAAGTCTCAGGTTCTCAGATCTTGGTCCTCTTCTTCTGAGTTTCAGGGTATAAAGCTTGTCTTTCATGTAAATAGAGGATTACCCAATAGGGTCAATTCGCGCTTGAGAGCTTCAACTGGGGCTCAGATGAGCTTTAGACTAGGGAAAGTTCAGAAATGGTGGGAAAAGGGGCTTCAACCCAACATGAAGGAGGTGACTTCGGCACAAGACTTTGTGGATTCACTGTTAAGCGCAGGGGACAAGTTGGTGGTGGTTGATTTCTTCTCTCCCGGTTGTGGTGGCTGCAAAGCCCTTCATCCTAAGATATGTCAATTTGCAGAGATGAATCCTGATGTTCAGTTCCTTCAGGTGAACTATGAGGAGCATAAGTCCATGTGTTATAGCCTTAATGTCCATGTTCTTCCCTTCTTCCGATTCTATAGAGGTGCTCATGGTCGATTATGTAGCTTTAGCTGCACCAATGCCACGATCAAGAAGTTTAAAGATGCATTGGCCAAACACACCCCAGATAGATGCAGCTTGGGCCCAACCAAAGGGTTAGAAGAGAAAGAGCTTCTAGCTCTTGCTGCCAACAAAGATCTTTCCTTCACCAACTCACCAGAACCTTTACAACCTGCACATGCAGATGAAGAGTTGGGAACCGAACCTGCTCCTGCTCCTGGTTCAAAATCTCTTCCTTCACCTTCAATGATTCTCAATTCTGAGGTCTCTAAAAAGAGAACCTTAACCACTTCAGGGAGATGA

>Glyma19g28550.1   sequence type=predicted peptide   gene model=Glyma19g28550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEVLTKASLVSSSSSSWHGVGQRHHRRVSTVSNTCSFGSGVGKFSSLKMKSQVLRSWSSSSEFQGIKLVFHVNRGLPNRVNSRLRASTGAQMSFRLGKVQKWWEKGLQPNMKEVTSAQDFVDSLLSAGDKLVVVDFFSPGCGGCKALHPKICQFAEMNPDVQFLQVNYEEHKSMCYSLNVHVLPFFRFYRGAHGRLCSFSCTNATIKKFKDALAKHTPDRCSLGPTKGLEEKELLALAANKDLSFTNSPEPLQPAHADEELGTEPAPAPGSKSLPSPSMILNSEVSKKRTLTTSGR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo