Glyma19g28390 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g28390

Feature Type:	gene_model
Chromosome:	Gm19
Start:	35849981
stop:	35852216
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g28390

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G65480	AT	Annotation by Michelle Graham. TAIR10: PEBP (phosphatidylethanolamine-binding protein) family protein \| chr1:24331510-24333689 FORWARD LENGTH=175	SoyBase	E_val: 7.00E-94	ISS
GO:0009909	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of flower development	SoyBase	N/A	ISS
GO:0009911	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of flower development	SoyBase	N/A	ISS
GO:0010119	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of stomatal movement	SoyBase	N/A	ISS
GO:0048573	GO-bp	Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0008429	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphatidylethanolamine binding	SoyBase	N/A	ISS
KOG3346	KOG	Phosphatidylethanolamine binding protein	JGI		ISS
PTHR11362	Panther	PHOSPHATIDYLETHANOLAMINE-BINDING PROTEIN	JGI		ISS
PF01161	PFAM	Phosphatidylethanolamine-binding protein	JGI		ISS
UniRef100_E3NYP2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Flowering locus T-like protein 2 n=1 Tax=Glycine max RepID=E3NYP2_SOYBN	SoyBase	E_val: 6.00E-123	ISS
UniRef100_I1N850	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N850_SOYBN	SoyBase	E_val: 1.00E-123	ISS

Proteins Associated with Glyma19g28390

Locus	Gene Symbol	Protein Name
	FT3b	Flowering locus T gene 3b
	FTL2	Flowering locus T-like gene 2
	FT3b	Flowering Locus T 3 gene b
	FT3b	Flowering Locus T 3 gene b

Expression Patterns of Glyma19g28390

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g28390

Paralog	Evidence	Comments
Glyma16g04840	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g28390 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g108100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g28390

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g28390

Limit To All Plant Sequences

>Glyma19g28390.1   sequence type=CDS   gene model=Glyma19g28390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTGGCGGTAGTAGGAACCCTCTTGTTGTTGGGCGTGTTATAGGGGAAGTAATAGATCCCTTTGAAATTTCTATTCCTTTCAGGGTCACCTATGGTAATAGAGAAGTGGGCAATGGTTGTGAGCTTAAACCTTCCCAAGTTGCCAACCAACCCAGAGTGAGTGTTGGTGGAGATGACCTCAGGAACTTCTACACTATGGTCCTGGTGGATCCTGATGCTCCTAGCCCAAGTAACCCTAATTTCAGGGAGTACCTTCATTGGTTGGTGACTGATATTCCAGAAACTACAGGGCCTAATTTCGGTAACGAGGTTGTAAGCTATGAAAGCCCACGACCCACGATGGGGATTCATCGGTTGGTGTTTGTGTTATTCCGTCAACAGTTTAGACAGAGGGTGTATGCTCCTGGATGGCGACAAAATTTCAATACCAGAGAATTTGCTGAACTTTACAACCTTGGATTGCCGGTTGCTGCTGTCTTCTTCAACTGTCAGAGGGAAAGTGGCTCTGGTGGTAGAACATTTTGA

Predicted protein sequences of Glyma19g28390

Limit To All Plant Sequences

>Glyma19g28390.1   sequence type=predicted peptide   gene model=Glyma19g28390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPGGSRNPLVVGRVIGEVIDPFEISIPFRVTYGNREVGNGCELKPSQVANQPRVSVGGDDLRNFYTMVLVDPDAPSPSNPNFREYLHWLVTDIPETTGPNFGNEVVSYESPRPTMGIHRLVFVLFRQQFRQRVYAPGWRQNFNTREFAELYNLGLPVAAVFFNCQRESGSGGRTF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain