SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma19g27901

Feature Type:gene_model
Chromosome:Gm19
Start:35245344
stop:35245843
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G17310AT Annotation by Michelle Graham. TAIR10: UDP-glucose pyrophosphorylase 2 | chr5:5696955-5699671 REVERSE LENGTH=390 SoyBaseE_val: 4.00E-29ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0010264GO-bp Annotation by Michelle Graham. GO Biological Process: myo-inositol hexakisphosphate biosynthetic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0052543GO-bp Annotation by Michelle Graham. GO Biological Process: callose deposition in cell wall SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003983GO-mf Annotation by Michelle Graham. GO Molecular Function: UTP:glucose-1-phosphate uridylyltransferase activity SoyBaseN/AISS
GO:0016779GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotidyltransferase activity SoyBaseN/AISS
PTHR11952Panther UDP- GLUCOSE PYROPHOSPHORYLASE JGI ISS
PTHR11952:SF1Panther UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE JGI ISS
PF01704PFAM UTP--glucose-1-phosphate uridylyltransferase JGI ISS
UniRef100_G7J7Y7UniRef Annotation by Michelle Graham. Best UniRef hit: UTP-glucose-1-phosphate uridylyltransferase n=1 Tax=Medicago truncatula RepID=G7J7Y7_MEDTR SoyBaseE_val: 8.00E-31ISS
UniRef100_G7J7Y7UniRef Annotation by Michelle Graham. Most informative UniRef hit: UTP-glucose-1-phosphate uridylyltransferase n=1 Tax=Medicago truncatula RepID=G7J7Y7_MEDTR SoyBaseE_val: 8.00E-31ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g27901 not represented in the dataset

Glyma19g27901 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g104700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g27901.1   sequence type=CDS   gene model=Glyma19g27901   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCATAGTAGTTTTGTTGGAATTTACAAATTATAATTCAATGTCTATCTTTATCCAGGTTAGTGAATTTAATTCTAAAGAGAAATTCAAAATTTTCAACACAAATAATTTGTGGGTAAACTTAAAAGCAGTTAAAAGGCTTGTTGAAGCTGATGCTCTGAAGATGGAAATTATTCACAATCCAAAGGAAGTCAATGGAGTAAAAGTTCTTCAATTGGAAACTAGAGCTGGTGCAACAACAAGGGTACTGGATGTTTACTAA

>Glyma19g27901.1   sequence type=predicted peptide   gene model=Glyma19g27901   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIIVVLLEFTNYNSMSIFIQVSEFNSKEKFKIFNTNNLWVNLKAVKRLVEADALKMEIIHNPKEVNGVKVLQLETRAGATTRVLDVY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo