Glyma19g27616 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g27616

Feature Type:	gene_model
Chromosome:	Gm19
Start:	34913909
stop:	34914723
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g27616

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G48620	AT	Annotation by Michelle Graham. TAIR10: high mobility group A5 \| chr1:17974148-17976301 REVERSE LENGTH=479	SoyBase	E_val: 2.00E-17	ISS
GO:0006334	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleosome assembly	SoyBase	N/A	ISS
GO:0009294	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA mediated transformation	SoyBase	N/A	ISS
GO:0000786	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleosome	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
PF00538	PFAM	linker histone H1 and H5 family	JGI		ISS
UniRef100_Q93YH8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: HMG I/Y like protein n=1 Tax=Glycine max RepID=Q93YH8_SOYBN	SoyBase	E_val: 2.00E-24	ISS
UniRef100_UPI000233700A	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233700A related cluster n=1 Tax=unknown RepID=UPI000233700A	SoyBase	E_val: 7.00E-85	ISS

Expression Patterns of Glyma19g27616

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g27616 not represented in the dataset	Glyma19g27616 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g27616 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g102900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g27616

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g27616

Limit To All Plant Sequences

>Glyma19g27616.1   sequence type=CDS   gene model=Glyma19g27616   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATATACACGGCAATCGAGGCGCTGAAGGAGAAAGACGGTTCTAGCAAGAGGGCAATAGCGAAGTATATTGAGCAAGTGTATACGCAGCTTCCACCGAATCACTCAAACTTGTTGACTCAGCACTTGACTCACTTGAAGAGTAGGGGATTGCTCCAAATGGTAAAAAAATCTTACGCCCTTCCTAGATCTGTGCCCGTGTCTGTTCCTGGACCTGCACCCACCGAAGGGACATCAACAGTGCCGACTGTTGTTGTTGCCATCACGACGACTCCGAGGCCCAGAGGTCGGCCTCGCAAGGCCCAAAATCCAGTTCAGAACTCGCCTCTGGCTCAGGACACTGTCAACGTGCAGGTTCAGCAGAATGCCGAGCCGGTCTGGGCTGCGCTTGGGCTTGCAGACGAGATTGGGTTATGTAAATTACAAATGTTTTTTTTTCATTTATTTTTTAAAAACTTTAATTAG

Predicted protein sequences of Glyma19g27616

Limit To All Plant Sequences

>Glyma19g27616.1   sequence type=predicted peptide   gene model=Glyma19g27616   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIYTAIEALKEKDGSSKRAIAKYIEQVYTQLPPNHSNLLTQHLTHLKSRGLLQMVKKSYALPRSVPVSVPGPAPTEGTSTVPTVVVAITTTPRPRGRPRKAQNPVQNSPLAQDTVNVQVQQNAEPVWAALGLADEIGLCKLQMFFFHLFFKNFN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain