Report for Sequence Feature Glyma19g27580
Feature Type: gene_model
Chromosome: Gm19
Start: 34882234
stop: 34884637
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g27580
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G39130 AT
Annotation by Michelle Graham. TAIR10: RmlC-like cupins superfamily protein | chr5:15665638-15666413 REVERSE LENGTH=222
SoyBase E_val: 8.00E-88 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0048046 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: apoplast
SoyBase N/A ISS
GO:0030145 GO-mf
Annotation by Michelle Graham. GO Molecular Function: manganese ion binding
SoyBase N/A ISS
GO:0045735 GO-mf
Annotation by Michelle Graham. GO Molecular Function: nutrient reservoir activity
SoyBase N/A ISS
PF00190 PFAM
Cupin
JGI ISS
UniRef100_C7S8B7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Germin-like protein 3 n=1 Tax=Glycine max RepID=C7S8B7_SOYBN
SoyBase E_val: 3.00E-108 ISS
UniRef100_I1N811 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N811_SOYBN
SoyBase E_val: 1.00E-151 ISS
Expression Patterns of Glyma19g27580
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma19g27580 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g102700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g27580
Coding sequences of Glyma19g27580
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g27580.1 sequence type=CDS gene model=Glyma19g27580 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAAGTTATCTACTTCCTTGTTGCCATCTTGGCTTTGGCATCCTCCATTGTCTCTGCCTATGACCCTAGTCCGCTGCAAGATTTTTGTGTGGCAACCAATGAAACCAACGGTGTATATGTGAATGGAAAATTCTGCAAACATCCCAACCTCACGATTCCTGAAGATTTCTTCAGACATGTGGAACCCGGGAGCACTGCCAACCAATTGGGCTTAGGACTGAGTCCTGTGAATGTTGCACAATTACCTGGACTAAACACGCTTGGCGTGTCTATGTCTCGCATAGATTATGCACCAAAGGGTTTAAACCCTCCACACACTCACCCTCGAGGCACTGAGATGCTTATGGTCATGGAAGGCACTCTTTTTGTTGGATTTGTCTCCTCCAACCAAGACAATAATCGTCTCTTTTCCAAAGTGCTCAACAAGGGTGATGTGTTTGTGTTCCCAATTGGGCTCATTCATTTCCAATACAATGTGGGGAAAGGCAATGCTGTTGCCATCACTGCTTTTAGCAGTCAAAATGCAGGAGTTATCGGTATTTCAAGTGCTGTGTTTCTGTCTACTCCACCTATTCCTTCTGAGATTCTCGCCAAAGGTTTCCAAGTGGGACAGAATGTAATTGATGAGTTTCGTTGA
Predicted protein sequences of Glyma19g27580
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g27580.1 sequence type=predicted peptide gene model=Glyma19g27580 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKVIYFLVAILALASSIVSAYDPSPLQDFCVATNETNGVYVNGKFCKHPNLTIPEDFFRHVEPGSTANQLGLGLSPVNVAQLPGLNTLGVSMSRIDYAPKGLNPPHTHPRGTEMLMVMEGTLFVGFVSSNQDNNRLFSKVLNKGDVFVFPIGLIHFQYNVGKGNAVAITAFSSQNAGVIGISSAVFLSTPPIPSEILAKGFQVGQNVIDEFR*