SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g27510

Feature Type:gene_model
Chromosome:Gm19
Start:34840202
stop:34841101
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g27510
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G31410AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 1719 Blast hits to 1091 proteins in 184 species: Archae - 5; Bacteria - 24; Metazoa - 559; Fungi - 169; Plants - 192; Viruses - 1; Other Eukaryotes - 769 (source: NCBI BLink). | chr2:13392220-13392819 REVERSE LENGTH=199 SoyBaseE_val: 2.00E-64ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1N804UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N804_SOYBN SoyBaseE_val: 1.00E-135ISS
UniRef100_Q9SIC8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Arabidopsis thaliana RepID=Q9SIC8_ARATH SoyBaseE_val: 7.00E-62ISS

Expression Patterns of Glyma19g27510
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g27510
ParalogEvidenceComments
Glyma16g05370 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g27510 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g102200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g27510
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g27510
>Glyma19g27510.1   sequence type=CDS   gene model=Glyma19g27510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTGCACAATCGACTTTCGCTGCCTCGACGAGGGTTTCGGCGGCAAAACCTACAAGCGCAAGAGAGAGCAGCAGTCGCAGCCTCAGCACGACGACAACGCCATCGACGGCGCCTCTCTGATGGACACCGACGACGCACTCCCTCCGCCAGCGAAGCGATCGGCGGTGCCGTCGTCGGAGAATCCGGACAAGCCGGTGTTCGGGCAGGCGAGCTACGACGGCGTGATCGCCGGGAGGGTGTCGGGGCGGAAGTGGAAGCAGGTGCGGCAGCATAGGGCGTCGGCGGCGCAGGTGAGCCGGAAGGGGACGACGTTCGAGCAGAGGGAGAGGGAGAAGGTGATAAAGAAGGCGTACAAGGAGAGGATGATGGAGCTGAAGGAGGAGATTCGATTGAACAAGGTCGAGAAGAGGAAGAAGAGAGAGGAGAGGGAGAAGAAGAAGCAGGAGAATATTATCAGATCTGGAACCAAATTCCAGAAGATTACGAACCCTAATACGTTGAAGAAGATCGCCAAATCCAAGCAGAGGAAGCAGCTTAGGGTTGTTCCTGATGAGTTGCTTAGGAAATAG
Predicted protein sequences of Glyma19g27510
>Glyma19g27510.1   sequence type=predicted peptide   gene model=Glyma19g27510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MACTIDFRCLDEGFGGKTYKRKREQQSQPQHDDNAIDGASLMDTDDALPPPAKRSAVPSSENPDKPVFGQASYDGVIAGRVSGRKWKQVRQHRASAAQVSRKGTTFEQREREKVIKKAYKERMMELKEEIRLNKVEKRKKREEREKKKQENIIRSGTKFQKITNPNTLKKIAKSKQRKQLRVVPDELLRK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo