SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g27466

Feature Type:gene_model
Chromosome:Gm19
Start:34796394
stop:34798938
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g27466
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G26760AT Annotation by Michelle Graham. TAIR10: NAD(P)-binding Rossmann-fold superfamily protein | chr3:9843639-9844899 FORWARD LENGTH=300 SoyBaseE_val: 1.00E-60ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009741GO-bp Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
KOG0725 KOG Reductases with broad range of substrate specificities JGI ISS
PF00106PFAM short chain dehydrogenase JGI ISS
UniRef100_B9RGZ3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Short chain alcohol dehydrogenase, putative n=1 Tax=Ricinus communis RepID=B9RGZ3_RICCO SoyBaseE_val: 2.00E-81ISS
UniRef100_UPI000233E723UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E723 related cluster n=1 Tax=unknown RepID=UPI000233E723 SoyBaseE_val: 7.00E-132ISS

Expression Patterns of Glyma19g27466
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g27466 not represented in the dataset
Glyma19g27466 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g27466
ParalogEvidenceComments
Glyma16g05400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g27466 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g101900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g27466
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g27466
>Glyma19g27466.1   sequence type=CDS   gene model=Glyma19g27466   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAGCAACAGCAAGAAAAGGAAAGCAACGAAGGATGAAGGTGAAAAATGGAAGTGTGTAAATAGAAAAGGAAGCGCACAACTCCCAGTAATTATTGCTGACAATGACACGGAGCTTGGCCCACAAGTTGCAAAGGAGTTGGGCCCATTAGCCCGCTACGTGGAGTACGATGTCACAGTGGAGGCTCAAGTGGCGGAAGCCGTGAATGTTGTCATGGCCCACTACGGCAAGCTCGACATCATGTACAACAATGCGGGCATCCCAAGCCCATCAGTTCCACCAGGCATAGTAGACCTAGACCTTAATGAGCTTGATTTTGTCATGAAGATCAACAAAAGGGGAATGATTGCTGATATTAAGCATGCGGCCCGAGTCATGATTCTAGTGGGCTTAGGGTCCATTCTATGCACATCAAGCATAAGTGGGGATCCATGCATATCCCTAGCTCCAATTCCTACACCTATGGTTTTGGCTCAAATAGGGAAGTTTTATCCTGGTTTGACCCAAGAACAGATAGTGGGTATTGTGAATGGGTTTGGTGAGCTCGAAGGTGCTAAGTGTGAGGACATTGATGCCGCAAAGGCTCCTTTGTACTTGGCATCAGATGAAGCAAAGTTTATCTCAGGCCTAAACCTCATTGTGGATGGAGGATTCACCAGCTTTAAAAGTCTTACATGCCATCTCCAGATCAAACTGTTTAACCCTAGTTATTAA
Predicted protein sequences of Glyma19g27466
>Glyma19g27466.1   sequence type=predicted peptide   gene model=Glyma19g27466   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESNSKKRKATKDEGEKWKCVNRKGSAQLPVIIADNDTELGPQVAKELGPLARYVEYDVTVEAQVAEAVNVVMAHYGKLDIMYNNAGIPSPSVPPGIVDLDLNELDFVMKINKRGMIADIKHAARVMILVGLGSILCTSSISGDPCISLAPIPTPMVLAQIGKFYPGLTQEQIVGIVNGFGELEGAKCEDIDAAKAPLYLASDEAKFISGLNLIVDGGFTSFKSLTCHLQIKLFNPSY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo