SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g27440

Feature Type:gene_model
Chromosome:Gm19
Start:34711022
stop:34711372
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g27440
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G12845AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; Has 8 Blast hits to 8 proteins in 4 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 8; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:4379023-4379382 REVERSE LENGTH=119 SoyBaseE_val: 7.00E-16ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1N7Z8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N7Z8_SOYBN SoyBaseE_val: 7.00E-51ISS
UniRef100_Q9LPW5UniRef Annotation by Michelle Graham. Most informative UniRef hit: F13K23.10 protein n=2 Tax=Arabidopsis thaliana RepID=Q9LPW5_ARATH SoyBaseE_val: 7.00E-12ISS

Expression Patterns of Glyma19g27440
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g27440
ParalogEvidenceComments
Glyma16g05421 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g27440 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g101500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g27440
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g27440
>Glyma19g27440.2   sequence type=CDS   gene model=Glyma19g27440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGCTACTATGATCAAGTTATTATTTTACCTTGCCATTTTGGTTATCTTGCTTACCAATTCAAAGGGTGTGAGTTCAAGTTCAACTAGTGAGCCTACAATTTCAGCTTCTCCTGGTGTTTTGCCTTATGTGACTGCCCCAGATATTTCCTCATTTTTCCCCACTCCAAGAGCCAATCAACCAATGAGTTCTGGTGCTCCTTTTGAGGCCGAGGCACCAGCACCGGCACCCAGTTCAGGAGAGTTTGAGGGCAAGAAGTCTTCTGCTTCAGCTAGGTTGAATTGTGCAGGTGCCATTGTTGGTGTTCTACTATGTTGTGCCTTCTTAAGTAGCATAGTTGTTGTTTGA
Predicted protein sequences of Glyma19g27440
>Glyma19g27440.2   sequence type=predicted peptide   gene model=Glyma19g27440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAATMIKLLFYLAILVILLTNSKGVSSSSTSEPTISASPGVLPYVTAPDISSFFPTPRANQPMSSGAPFEAEAPAPAPSSGEFEGKKSSASARLNCAGAIVGVLLCCAFLSSIVVV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo