Report for Sequence Feature Glyma19g26400
Feature Type: gene_model
Chromosome: Gm19
Start: 33118585
stop: 33121094
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g26400
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G13080 AT
Annotation by Michelle Graham. TAIR10: WRKY DNA-binding protein 75 | chr5:4149928-4151019 REVERSE LENGTH=145
SoyBase E_val: 4.00E-57 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0009723 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus
SoyBase N/A ISS
GO:0016036 GO-bp
Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation
SoyBase N/A ISS
GO:0019375 GO-bp
Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process
SoyBase N/A ISS
GO:0032107 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of response to nutrient levels
SoyBase N/A ISS
GO:0042631 GO-bp
Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation
SoyBase N/A ISS
GO:0043620 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of DNA-dependent transcription in response to stress
SoyBase N/A ISS
GO:0048527 GO-bp
Annotation by Michelle Graham. GO Biological Process: lateral root development
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
GO:0043565 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding
SoyBase N/A ISS
PF03106 PFAM
WRKY DNA -binding domain
JGI ISS
UniRef100_C6TLQ2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TLQ2_SOYBN
SoyBase E_val: 2.00E-136 ISS
UniRef100_Q2PJS1 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: WRKY53 n=1 Tax=Glycine max RepID=Q2PJS1_SOYBN
SoyBase E_val: 3.00E-136 ISS
Proteins Associated with Glyma19g26400
Locus Gene Symbol Protein Name
WRKY53 WRKY Transcription Factor
Expression Patterns of Glyma19g26400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma19g26400
Paralog Evidence Comments
Glyma16g05880 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma19g26400 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g094100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g26400
Coding sequences of Glyma19g26400
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g26400.1 sequence type=CDS gene model=Glyma19g26400 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGAATTATTCCATGTTGTTCTCTGTTTCCAATTCCTCAAGCTACCCAATTGGAGTTGGAAGCTCTCAAATTGGTTATAGTGGTCAAAGCTCCAATGCGTTTCTTGGTCTAAGGCCTAGTAATGAATTAGCTAGTGATGATCATGAGAAGAGACAAGGTGGTGGTGATGGCAATATGTTAATGTCTCAGATCAGTGGTGGTAGCATTAATGTGAGTGATGAGTTAGGTGGTTCGGGAAATAGTAACAATAATAAAAAGAAAGGAGAGAAAAAGGTTAGAAAGCCTAGATATGCTTTTCAAACAAGGAGCCAGGTTGATATTCTTGATGATGGTTACCGATGGAGGAAGTATGGCCAAAAAGCTGTTAAAAACAACAAATTTCCAAGGAGCTACTACAGGTGCACGCATCAAGGGTGCAATGTGAAGAAGCAAGTGCAACGCTTAACCAAAGACGAAGGAGTAGTGGTAACCACTTATGAGGGAGTGCACACACACCCAATTGAGAAGACAACAGATAACTTTGAGCACATTTTGAGTCAGATGCAAATATACACTCCCTTCTGA
Predicted protein sequences of Glyma19g26400
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g26400.1 sequence type=predicted peptide gene model=Glyma19g26400 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MENYSMLFSVSNSSSYPIGVGSSQIGYSGQSSNAFLGLRPSNELASDDHEKRQGGGDGNMLMSQISGGSINVSDELGGSGNSNNNKKKGEKKVRKPRYAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGVHTHPIEKTTDNFEHILSQMQIYTPF*