SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g25655): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g25655): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g25655

Feature Type:gene_model
Chromosome:Gm19
Start:31750671
stop:31752104
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g25655
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G23570AT Annotation by Michelle Graham. TAIR10: XS domain-containing protein / XS zinc finger domain-containing protein-related | chr5:7943621-7945874 FORWARD LENGTH=625 SoyBaseE_val: 6.00E-13ISS
GO:0009616GO-bp Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing SoyBaseN/AISS
GO:0010025GO-bp Annotation by Michelle Graham. GO Biological Process: wax biosynthetic process SoyBaseN/AISS
GO:0010050GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative phase change SoyBaseN/AISS
GO:0010267GO-bp Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference SoyBaseN/AISS
GO:0035196GO-bp Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA SoyBaseN/AISS
GO:0051607GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to virus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
UniRef100_G7J2Q1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein SUPPRESSOR OF GENE SILENCING-like protein n=1 Tax=Medicago truncatula RepID=G7J2Q1_MEDTR SoyBaseE_val: 7.00E-41ISS
UniRef100_I1KBU1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KBU1_SOYBN SoyBaseE_val: 1.00E-64ISS

Expression Patterns of Glyma19g25655
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g25655 not represented in the dataset
Glyma19g25655 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g25655 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma19g25655
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g25655
>Glyma19g25655.1   sequence type=CDS   gene model=Glyma19g25655   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGAAAATTGCATTGTGAGGAGGAGAACTAAAATGCAACATGAAGAGACCAAAGAAGAGATGTATATGCAAGAACAATTCTTCAAGGACCAGATCAAAATCATTCATGATTCAAGGGATGCGAAGGAAGAAGATATCAAGAGGATGCAACCGGAGGAATGTGAGAAGGTGAAGCAGTCATGTACTACTGGTCATGTGAATGCTAAGGAATATAGACTCAAGGTGGAAGAGTATCTGAAATTTGTTGAGGTCCAAGATAAAGAAATGGAGAACTTAGTTGCTGAAAAGGAGAAGTTGTTACATGCTTGTGGCATGGGTTATGCTGCAATGAAGTCGAGGCATTGGGAGGAAGAAGTTTAG
Predicted protein sequences of Glyma19g25655
>Glyma19g25655.1   sequence type=predicted peptide   gene model=Glyma19g25655   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDENCIVRRRTKMQHEETKEEMYMQEQFFKDQIKIIHDSRDAKEEDIKRMQPEECEKVKQSCTTGHVNAKEYRLKVEEYLKFVEVQDKEMENLVAEKEKLLHACGMGYAAMKSRHWEEEV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo