|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G23570 | AT | Annotation by Michelle Graham. TAIR10: XS domain-containing protein / XS zinc finger domain-containing protein-related | chr5:7943621-7945874 FORWARD LENGTH=625 | SoyBase | E_val: 6.00E-13 | ISS |
| GO:0009616 | GO-bp | Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing | SoyBase | N/A | ISS |
| GO:0010025 | GO-bp | Annotation by Michelle Graham. GO Biological Process: wax biosynthetic process | SoyBase | N/A | ISS |
| GO:0010050 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative phase change | SoyBase | N/A | ISS |
| GO:0010267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference | SoyBase | N/A | ISS |
| GO:0035196 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA | SoyBase | N/A | ISS |
| GO:0051607 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to virus | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005783 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| UniRef100_G7J2Q1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Protein SUPPRESSOR OF GENE SILENCING-like protein n=1 Tax=Medicago truncatula RepID=G7J2Q1_MEDTR | SoyBase | E_val: 7.00E-41 | ISS |
| UniRef100_I1KBU1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KBU1_SOYBN | SoyBase | E_val: 1.00E-64 | ISS |
|
Glyma19g25655 not represented in the dataset |
Glyma19g25655 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g25655.1 sequence type=CDS gene model=Glyma19g25655 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGATGAAAATTGCATTGTGAGGAGGAGAACTAAAATGCAACATGAAGAGACCAAAGAAGAGATGTATATGCAAGAACAATTCTTCAAGGACCAGATCAAAATCATTCATGATTCAAGGGATGCGAAGGAAGAAGATATCAAGAGGATGCAACCGGAGGAATGTGAGAAGGTGAAGCAGTCATGTACTACTGGTCATGTGAATGCTAAGGAATATAGACTCAAGGTGGAAGAGTATCTGAAATTTGTTGAGGTCCAAGATAAAGAAATGGAGAACTTAGTTGCTGAAAAGGAGAAGTTGTTACATGCTTGTGGCATGGGTTATGCTGCAATGAAGTCGAGGCATTGGGAGGAAGAAGTTTAG
>Glyma19g25655.1 sequence type=predicted peptide gene model=Glyma19g25655 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MDENCIVRRRTKMQHEETKEEMYMQEQFFKDQIKIIHDSRDAKEEDIKRMQPEECEKVKQSCTTGHVNAKEYRLKVEEYLKFVEVQDKEMENLVAEKEKLLHACGMGYAAMKSRHWEEEV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||