SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g25650

Feature Type:gene_model
Chromosome:Gm19
Start:31743570
stop:31745227
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g25650
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G06860AT Annotation by Michelle Graham. TAIR10: multifunctional protein 2 | chr3:2161926-2166009 FORWARD LENGTH=725 SoyBaseE_val: 2.00E-33ISS
GO:0006631GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid metabolic process SoyBaseN/AISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0007031GO-bp Annotation by Michelle Graham. GO Biological Process: peroxisome organization SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009062GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0003857GO-mf Annotation by Michelle Graham. GO Molecular Function: 3-hydroxyacyl-CoA dehydrogenase activity SoyBaseN/AISS
GO:0004300GO-mf Annotation by Michelle Graham. GO Molecular Function: enoyl-CoA hydratase activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016508GO-mf Annotation by Michelle Graham. GO Molecular Function: long-chain-enoyl-CoA hydratase activity SoyBaseN/AISS
GO:0016616GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor SoyBaseN/AISS
GO:0050662GO-mf Annotation by Michelle Graham. GO Molecular Function: coenzyme binding SoyBaseN/AISS
PTHR23309Panther 3-HYDROXYACYL-COA DEHYROGENASE JGI ISS
PF00378PFAM Enoyl-CoA hydratase/isomerase family JGI ISS
PF02737PFAM 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain JGI ISS
UniRef100_B0M199UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peroxisomal fatty acid beta-oxidation multifunctional protein n=1 Tax=Glycine max RepID=B0M199_SOYBN SoyBaseE_val: 1.00E-37ISS
UniRef100_UPI000233E445UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E445 related cluster n=1 Tax=unknown RepID=UPI000233E445 SoyBaseE_val: 5.00E-102ISS

Expression Patterns of Glyma19g25650
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g25650 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g089400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g25650
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g25650
>Glyma19g25650.1   sequence type=CDS   gene model=Glyma19g25650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGGAAAGGAATAAAATCTCCCCTTCCTTTTTTTGGTTTAATTTCGTGGGAAAAAAAGAATAAATATATGTATGATGGGTGCACATTTTCTAATTCTTTCCTCTCCCTTCTTATAGAGCATCCAAAACCTGCGGCTAGGAAACCATCAGATGTTGCCATTGATGGTCTTGCCTTGGATGGAGGCTTAGAAGTTGCAATGGCATGCAATGCTCGGTTATCAACTCCAACTACTCAGCTAGGCTTGCCTAAACTTCAGCTTGGAATAATTCCTGGATTTGGAGGAACACAGCGACTTCCTCGTCTTGTTGGTTTGACAAAGGGACTTGAGATGATACTGGTATACTACATTTTTGAAGTTGTACCTGGGGTTACAGATTGTGGTCTGGTTCCAAGACAAGTCAAGAAGCTTGCCATCATTGGCGGAGGACTAATGGGCTCTGGAATAGCAACTGCTTTAATTCTTAGCAACTATACTGTCATCTTGAATGAAGTAAATGAGAAGTTCTTAGATGTTGGTATGAATAGGATTAAAGGAAACCTACAAAACTGTGTTAAGAAAGGTAAATTGACCAAGGAAAATTTTGAAAAGACCATCTCTCTTATCAAAGGTATGAATAATGTCTTTCATAAACAATATTTTAAACTAACATGCATCAACCATTCATTGCCTTATGTGAAACTTTTGGTTTCCTTTCCTTTGCCTACTTTTATATTTCTAGCTTCTCTTCTGGTTTCCTTTGAAGCTGATAAAGAGCAATTGGGATAA
Predicted protein sequences of Glyma19g25650
>Glyma19g25650.1   sequence type=predicted peptide   gene model=Glyma19g25650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GKGIKSPLPFFGLISWEKKNKYMYDGCTFSNSFLSLLIEHPKPAARKPSDVAIDGLALDGGLEVAMACNARLSTPTTQLGLPKLQLGIIPGFGGTQRLPRLVGLTKGLEMILVYYIFEVVPGVTDCGLVPRQVKKLAIIGGGLMGSGIATALILSNYTVILNEVNEKFLDVGMNRIKGNLQNCVKKGKLTKENFEKTISLIKGMNNVFHKQYFKLTCINHSLPYVKLLVSFPLPTFIFLASLLVSFEADKEQLG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo