SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G15750 | AT | Annotation by Michelle Graham. TAIR10: Alpha-L RNA-binding motif/Ribosomal protein S4 family protein | chr5:5141449-5142701 FORWARD LENGTH=182 | SoyBase | E_val: 8.00E-48 | ISS |
| GO:0006626 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0022627 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit | SoyBase | N/A | ISS |
| GO:0003723 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding | SoyBase | N/A | ISS |
| GO:0019843 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: rRNA binding | SoyBase | N/A | ISS |
| PTHR11831 | Panther | 30S 40S RIBOSOMAL PROTEIN | JGI | ISS | |
| PTHR11831:SF1 | Panther | 40S RIBOSOMAL PROTEIN S9 | JGI | ISS | |
| UniRef100_G7L7F8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: U3 small nucleolar ribonucleoprotein IMP3 n=1 Tax=Medicago truncatula RepID=G7L7F8_MEDTR | SoyBase | E_val: 1.00E-51 | ISS |
| UniRef100_I1N7Q7 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N7Q7_SOYBN | SoyBase | E_val: 1.00E-65 | ISS |
|
Glyma19g25640 not represented in the dataset |
Glyma19g25640 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma16g06220 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.19g089300 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g25640.2 sequence type=CDS gene model=Glyma19g25640 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATAACTTTTTTAAGACAATTTTTTAACAACCGTCGTGAAAAATATTCAGGTTTATGCCATATGGTTCAGAAGTTGGTAAACATATTGAAACAAATGGACCCAAAGGATCCTTTTCGGATTGATATGATTGATAAGCTTCTGGAAAAATTGCAAAGTATCATGTTATGCGAACGCTTAACTATCTCATCCTTCTGCAAGCGTAGGCTCTCAATTGTTTTTTTGCGACTAAAATTTGCGGAGCACTTGAAAGAAGCTGTCACATATATTGAGATAAGAGTTGGTCCAAAGACAGCTACAGATCCAGCTTTCGTTGTAACTAGAAACATGGAAGACTTTGTTACATAG
>Glyma19g25640.2 sequence type=predicted peptide gene model=Glyma19g25640 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MITFLRQFFNNRREKYSGLCHMVQKLVNILKQMDPKDPFRIDMIDKLLEKLQSIMLCERLTISSFCKRRLSIVFLRLKFAEHLKEAVTYIEIRVGPKTATDPAFVVTRNMEDFVT*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
