Glyma19g24613 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g24613

Feature Type:	gene_model
Chromosome:	Gm19
Start:	30257758
stop:	30258478
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g24613

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G19490	AT	Annotation by Michelle Graham. TAIR10: Basic-leucine zipper (bZIP) transcription factor family protein \| chr1:6751953-6753959 REVERSE LENGTH=471	SoyBase	E_val: 5.00E-20	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
GO:0046983	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity	SoyBase	N/A	ISS
UniRef100_G7L602	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: BZIP transcription factor bZIP39 n=1 Tax=Medicago truncatula RepID=G7L602_MEDTR	SoyBase	E_val: 8.00E-59	ISS
UniRef100_I1N7L5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N7L5_SOYBN	SoyBase	E_val: 4.00E-97	ISS

Expression Patterns of Glyma19g24613

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g24613 not represented in the dataset	Glyma19g24613 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g24613 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g084800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g24613

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g24613

Limit To All Plant Sequences

>Glyma19g24613.1   sequence type=CDS   gene model=Glyma19g24613   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GCTCTGTATGAGGAGTTAACTAGAAAAGTTGTCACTTTGGTGGCAGAGAATGAAAACCTAAAGAGGGAGAAAGAATTGGCTTTGAAAGAGTATGAGTCTTTGGAGACTACAAATAAGAACTTGAAGACACAGATAGCCAAGTCAATAAACACTGAAGTGGAGAAAACTCCTGTTGAGCCTGTGTCATCTGTGGCTGAGATAACACCTTCATCCGGTAATGGTCCATGGTTCCTTTATAACCTTTTTCCAGTTCCACAAATATTTTGGCCTTCCATCCTTCAATCTTCTAATCCAATTCATCTACAAAATACATCATTTAATTCCATCGCCATTCCACCTAATGCTAATGTTTCATGTTCTTCTGAGTCTGAATCACATCACAAGCAAAATAACCTTATAAATGATAATCGAACTCGAGTAATCACTTTTTAA

Predicted protein sequences of Glyma19g24613

Limit To All Plant Sequences

>Glyma19g24613.1   sequence type=predicted peptide   gene model=Glyma19g24613   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ALYEELTRKVVTLVAENENLKREKELALKEYESLETTNKNLKTQIAKSINTEVEKTPVEPVSSVAEITPSSGNGPWFLYNLFPVPQIFWPSILQSSNPIHLQNTSFNSIAIPPNANVSCSSESESHHKQNNLINDNRTRVITF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain