SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma19g24613

Feature Type:gene_model
Chromosome:Gm19
Start:30257758
stop:30258478
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G19490AT Annotation by Michelle Graham. TAIR10: Basic-leucine zipper (bZIP) transcription factor family protein | chr1:6751953-6753959 REVERSE LENGTH=471 SoyBaseE_val: 5.00E-20ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
UniRef100_G7L602UniRef Annotation by Michelle Graham. Most informative UniRef hit: BZIP transcription factor bZIP39 n=1 Tax=Medicago truncatula RepID=G7L602_MEDTR SoyBaseE_val: 8.00E-59ISS
UniRef100_I1N7L5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N7L5_SOYBN SoyBaseE_val: 4.00E-97ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g24613 not represented in the dataset

Glyma19g24613 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g084800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g24613.1   sequence type=CDS   gene model=Glyma19g24613   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GCTCTGTATGAGGAGTTAACTAGAAAAGTTGTCACTTTGGTGGCAGAGAATGAAAACCTAAAGAGGGAGAAAGAATTGGCTTTGAAAGAGTATGAGTCTTTGGAGACTACAAATAAGAACTTGAAGACACAGATAGCCAAGTCAATAAACACTGAAGTGGAGAAAACTCCTGTTGAGCCTGTGTCATCTGTGGCTGAGATAACACCTTCATCCGGTAATGGTCCATGGTTCCTTTATAACCTTTTTCCAGTTCCACAAATATTTTGGCCTTCCATCCTTCAATCTTCTAATCCAATTCATCTACAAAATACATCATTTAATTCCATCGCCATTCCACCTAATGCTAATGTTTCATGTTCTTCTGAGTCTGAATCACATCACAAGCAAAATAACCTTATAAATGATAATCGAACTCGAGTAATCACTTTTTAA

>Glyma19g24613.1   sequence type=predicted peptide   gene model=Glyma19g24613   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ALYEELTRKVVTLVAENENLKREKELALKEYESLETTNKNLKTQIAKSINTEVEKTPVEPVSSVAEITPSSGNGPWFLYNLFPVPQIFWPSILQSSNPIHLQNTSFNSIAIPPNANVSCSSESESHHKQNNLINDNRTRVITF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo