|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G28910 | AT | Annotation by Michelle Graham. TAIR10: myb domain protein 30 | chr3:10911443-10912856 FORWARD LENGTH=323 | SoyBase | E_val: 6.00E-35 | ISS |
GO:0009617 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to bacterium | SoyBase | N/A | ISS |
GO:0009626 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plant-type hypersensitive response | SoyBase | N/A | ISS |
GO:0009723 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus | SoyBase | N/A | ISS |
GO:0009733 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus | SoyBase | N/A | ISS |
GO:0009739 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus | SoyBase | N/A | ISS |
GO:0009751 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus | SoyBase | N/A | ISS |
GO:0009753 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus | SoyBase | N/A | ISS |
GO:0042761 | GO-bp | Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid biosynthetic process | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS |
GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
PTHR10641 | Panther | MYB-RELATED | JGI | ISS | |
PF00249 | PFAM | Myb-like DNA-binding domain | JGI | ISS | |
UniRef100_E4W6I5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor MYB392 n=1 Tax=Glycine max RepID=E4W6I5_SOYBN | SoyBase | E_val: 3.00E-37 | ISS |
UniRef100_I1L293 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1L293_SOYBN | SoyBase | E_val: 2.00E-40 | ISS |
Glyma19g24531 not represented in the dataset |
Glyma19g24531 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.19g084000 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g24531.1 sequence type=CDS gene model=Glyma19g24531 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTGCATCAAGCAAAGAGAAAGCCGACAACACATCATATTGGTGTCTTATATTCAGGAACATGGTCCTGGAAATTGGAGGGCAGTTCTTGCCAAAACAGGGTTTTCAAGATGCAGCAAGAGTTGCAGACTTAGATCAACTAATTACCTGAGGCCAGGAATCAAACAAGGCAACTTCTCAGAACAAGAGGAGAAGATGATAATCCATCTTCAAGATCTTTTAGGAAACAGGTACAAATCAATCTTCCAAGCACCTACTTAG
>Glyma19g24531.1 sequence type=predicted peptide gene model=Glyma19g24531 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MCIKQRESRQHIILVSYIQEHGPGNWRAVLAKTGFSRCSKSCRLRSTNYLRPGIKQGNFSEQEEKMIIHLQDLLGNRYKSIFQAPT*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||