|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G52360 | AT | Annotation by Michelle Graham. TAIR10: Coatomer, beta' subunit | chr1:19499282-19505397 FORWARD LENGTH=926 | SoyBase | E_val: 4.00E-62 | ISS |
| GO:0006094 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gluconeogenesis | SoyBase | N/A | ISS |
| GO:0006886 | GO-bp | Annotation by Michelle Graham. GO Biological Process: intracellular protein transport | SoyBase | N/A | ISS |
| GO:0007010 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization | SoyBase | N/A | ISS |
| GO:0010498 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process | SoyBase | N/A | ISS |
| GO:0016192 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0030117 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane coat | SoyBase | N/A | ISS |
| GO:0030126 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: COPI vesicle coat | SoyBase | N/A | ISS |
| GO:0005198 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural molecule activity | SoyBase | N/A | ISS |
| PTHR19876 | Panther | COATOMER | JGI | ISS | |
| PTHR19876:SF2 | Panther | COATOMER ALPHA SUBUNIT | JGI | ISS | |
| PF04053 | PFAM | Coatomer WD associated region | JGI | ISS | |
| UniRef100_B9SQC0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Coatomer beta subunit, putative n=1 Tax=Ricinus communis RepID=B9SQC0_RICCO | SoyBase | E_val: 3.00E-60 | ISS |
| UniRef100_I1MCM5 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MCM5_SOYBN | SoyBase | E_val: 2.00E-63 | ISS |
|
Glyma19g24460 not represented in the dataset |
Glyma19g24460 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g24460.1 sequence type=CDS gene model=Glyma19g24460 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high TCAAACAGGGTTGTGATTGGCTATGATGAAGGAACAATTATGGTCAAACTTGGTCGAGAAGTACCTGTGGCTAGCATGAACAACAGTGGGAAAATTATTTGGTTTAAGCATAATGAAATTCAGACTGTCAATATAAAAAGTGTAGGAGCATATGTAGAGGTTGCCGACCGAGAAAGGTTACCTTTAGCTGTTAAGGAGTTGGGCACCTGTGATCTCTACCCCCAAAATTTAAAGCACAATCCAAATGGAAGGTTAGTTGTTGTATGTGGAGAGGGCGAATACATCATATACACTGCATTGGCATGGAGAAATAGGTCATTTGGTTCAGCACTGGAT
>Glyma19g24460.1 sequence type=predicted peptide gene model=Glyma19g24460 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high SNRVVIGYDEGTIMVKLGREVPVASMNNSGKIIWFKHNEIQTVNIKSVGAYVEVADRERLPLAVKELGTCDLYPQNLKHNPNGRLVVVCGEGEYIIYTALAWRNRSFGSALD
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||