SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g24460

Feature Type:gene_model
Chromosome:Gm19
Start:30049315
stop:30050088
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g24460
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G52360AT Annotation by Michelle Graham. TAIR10: Coatomer, beta' subunit | chr1:19499282-19505397 FORWARD LENGTH=926 SoyBaseE_val: 4.00E-62ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0030117GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane coat SoyBaseN/AISS
GO:0030126GO-cc Annotation by Michelle Graham. GO Cellular Compartment: COPI vesicle coat SoyBaseN/AISS
GO:0005198GO-mf Annotation by Michelle Graham. GO Molecular Function: structural molecule activity SoyBaseN/AISS
PTHR19876Panther COATOMER JGI ISS
PTHR19876:SF2Panther COATOMER ALPHA SUBUNIT JGI ISS
PF04053PFAM Coatomer WD associated region JGI ISS
UniRef100_B9SQC0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Coatomer beta subunit, putative n=1 Tax=Ricinus communis RepID=B9SQC0_RICCO SoyBaseE_val: 3.00E-60ISS
UniRef100_I1MCM5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MCM5_SOYBN SoyBaseE_val: 2.00E-63ISS

Expression Patterns of Glyma19g24460
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g24460 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma19g24460
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g24460
>Glyma19g24460.1   sequence type=CDS   gene model=Glyma19g24460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCAAACAGGGTTGTGATTGGCTATGATGAAGGAACAATTATGGTCAAACTTGGTCGAGAAGTACCTGTGGCTAGCATGAACAACAGTGGGAAAATTATTTGGTTTAAGCATAATGAAATTCAGACTGTCAATATAAAAAGTGTAGGAGCATATGTAGAGGTTGCCGACCGAGAAAGGTTACCTTTAGCTGTTAAGGAGTTGGGCACCTGTGATCTCTACCCCCAAAATTTAAAGCACAATCCAAATGGAAGGTTAGTTGTTGTATGTGGAGAGGGCGAATACATCATATACACTGCATTGGCATGGAGAAATAGGTCATTTGGTTCAGCACTGGAT
Predicted protein sequences of Glyma19g24460
>Glyma19g24460.1   sequence type=predicted peptide   gene model=Glyma19g24460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SNRVVIGYDEGTIMVKLGREVPVASMNNSGKIIWFKHNEIQTVNIKSVGAYVEVADRERLPLAVKELGTCDLYPQNLKHNPNGRLVVVCGEGEYIIYTALAWRNRSFGSALD






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo