Glyma19g24451 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g24451): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g24451): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g24451

Feature Type:	gene_model
Chromosome:	Gm19
Start:	30045006
stop:	30045828
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g24451

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G47460	AT	Annotation by Michelle Graham. TAIR10: myb domain protein 12 \| chr2:19476438-19479242 FORWARD LENGTH=371	SoyBase	E_val: 3.00E-40	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0009744	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus	SoyBase	N/A	ISS
GO:0009813	GO-bp	Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process	SoyBase	N/A	ISS
GO:0010224	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to UV-B	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PTHR10641	Panther	MYB-RELATED	JGI		ISS
PF00249	PFAM	Myb-like DNA-binding domain	JGI		ISS
UniRef100_I1NBA9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NBA9_SOYBN	SoyBase	E_val: 3.00E-51	ISS
UniRef100_Q2LME2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: MYB22 n=2 Tax=Malus x domestica RepID=Q2LME2_MALDO	SoyBase	E_val: 7.00E-44	ISS

Expression Patterns of Glyma19g24451

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g24451 not represented in the dataset	Glyma19g24451 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g24451 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g083700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g24451

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g24451

Limit To All Plant Sequences

>Glyma19g24451.1   sequence type=CDS   gene model=Glyma19g24451   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAAGGGCTCGTTGTTGTGAGAAAGTGGGATTGAAAAAGGGAAGGTGGACAACGGAGGAGGAAGAAATTTTGACCAAGTACATTATGGCCAATGGAGAAGGTTCGTGGAGATCATTGCCGAAAAATACAGGATTGTTGAGATGCGGGAACAGTTGCAGGCTAAGGTGGATTAACTATTTAAGAGCTGATCTCAAAAGAGGAACCTTTTCTGTTGAGGAGGAAAGTACGATTCTGAAGTTGCATGCTTCGTTTGGCAGCAGGTTGAGAAGAATTTGA

Predicted protein sequences of Glyma19g24451

Limit To All Plant Sequences

>Glyma19g24451.1   sequence type=predicted peptide   gene model=Glyma19g24451   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVRARCCEKVGLKKGRWTTEEEEILTKYIMANGEGSWRSLPKNTGLLRCGNSCRLRWINYLRADLKRGTFSVEEESTILKLHASFGSRLRRI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain