SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g24451

Feature Type:gene_model
Chromosome:Gm19
Start:30045006
stop:30045828
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g24451
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G47460AT Annotation by Michelle Graham. TAIR10: myb domain protein 12 | chr2:19476438-19479242 FORWARD LENGTH=371 SoyBaseE_val: 3.00E-40ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009813GO-bp Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process SoyBaseN/AISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PTHR10641Panther MYB-RELATED JGI ISS
PF00249PFAM Myb-like DNA-binding domain JGI ISS
UniRef100_I1NBA9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NBA9_SOYBN SoyBaseE_val: 3.00E-51ISS
UniRef100_Q2LME2UniRef Annotation by Michelle Graham. Most informative UniRef hit: MYB22 n=2 Tax=Malus x domestica RepID=Q2LME2_MALDO SoyBaseE_val: 7.00E-44ISS

Expression Patterns of Glyma19g24451
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g24451 not represented in the dataset
Glyma19g24451 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g24451 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g083700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g24451
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g24451
>Glyma19g24451.1   sequence type=CDS   gene model=Glyma19g24451   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAAGGGCTCGTTGTTGTGAGAAAGTGGGATTGAAAAAGGGAAGGTGGACAACGGAGGAGGAAGAAATTTTGACCAAGTACATTATGGCCAATGGAGAAGGTTCGTGGAGATCATTGCCGAAAAATACAGGATTGTTGAGATGCGGGAACAGTTGCAGGCTAAGGTGGATTAACTATTTAAGAGCTGATCTCAAAAGAGGAACCTTTTCTGTTGAGGAGGAAAGTACGATTCTGAAGTTGCATGCTTCGTTTGGCAGCAGGTTGAGAAGAATTTGA
Predicted protein sequences of Glyma19g24451
>Glyma19g24451.1   sequence type=predicted peptide   gene model=Glyma19g24451   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVRARCCEKVGLKKGRWTTEEEEILTKYIMANGEGSWRSLPKNTGLLRCGNSCRLRWINYLRADLKRGTFSVEEESTILKLHASFGSRLRRI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo