SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g23640

Feature Type:gene_model
Chromosome:Gm19
Start:29052814
stop:29053161
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g23640
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG01080AT Annotation by Michelle Graham. TAIR10: NADH:ubiquinone/plastoquinone oxidoreductase, chain 6 | chrC:118377-118907 REVERSE LENGTH=176 SoyBaseE_val: 9.00E-27ISS
GO:0006091GO-bp Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy SoyBaseN/AISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0045333GO-bp Annotation by Michelle Graham. GO Biological Process: cellular respiration SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003959GO-mf Annotation by Michelle Graham. GO Molecular Function: NADPH dehydrogenase activity SoyBaseN/AISS
GO:0008137GO-mf Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase (ubiquinone) activity SoyBaseN/AISS
UniRef100_I1N7I9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N7I9_SOYBN SoyBaseE_val: 8.00E-46ISS
UniRef100_Q2PMN5UniRef Annotation by Michelle Graham. Most informative UniRef hit: NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic n=1 Tax=Glycine max RepID=NU6C_SOYBN SoyBaseE_val: 1.00E-38ISS

Expression Patterns of Glyma19g23640
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g23640 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma19g23640
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g23640
>Glyma19g23640.1   sequence type=CDS   gene model=Glyma19g23640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATGGTTCGAAATATTACCAAGATTTTCGTCTTTGGACTGTTGGGGATGGAATTACTTTGATGGTTTGTACAAGTATCTTTGTTTCACTAATAACTACTATTCTAGATACATCATGGCGCGAGATTATTTGGACTACAAGACCCAATCAGATTATAGAGCAAGATTTGATAAGTACTAGTCAACAAATTGGAATTCATTTAGTGGAAGGATATGCCTGGTAG
Predicted protein sequences of Glyma19g23640
>Glyma19g23640.1   sequence type=predicted peptide   gene model=Glyma19g23640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNGSKYYQDFRLWTVGDGITLMVCTSIFVSLITTILDTSWREIIWTTRPNQIIEQDLISTSQQIGIHLVEGYAW*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo