|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
ATCG01080 | AT | Annotation by Michelle Graham. TAIR10: NADH:ubiquinone/plastoquinone oxidoreductase, chain 6 | chrC:118377-118907 REVERSE LENGTH=176 | SoyBase | E_val: 9.00E-27 | ISS |
GO:0006091 | GO-bp | Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy | SoyBase | N/A | ISS |
GO:0006354 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation | SoyBase | N/A | ISS |
GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
GO:0019684 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction | SoyBase | N/A | ISS |
GO:0045333 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular respiration | SoyBase | N/A | ISS |
GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0003959 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: NADPH dehydrogenase activity | SoyBase | N/A | ISS |
GO:0008137 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase (ubiquinone) activity | SoyBase | N/A | ISS |
UniRef100_I1N7I9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N7I9_SOYBN | SoyBase | E_val: 8.00E-46 | ISS |
UniRef100_Q2PMN5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic n=1 Tax=Glycine max RepID=NU6C_SOYBN | SoyBase | E_val: 1.00E-38 | ISS |
Glyma19g23640 not represented in the dataset |
Glyma19g23640 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g23640.1 sequence type=CDS gene model=Glyma19g23640 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAATGGTTCGAAATATTACCAAGATTTTCGTCTTTGGACTGTTGGGGATGGAATTACTTTGATGGTTTGTACAAGTATCTTTGTTTCACTAATAACTACTATTCTAGATACATCATGGCGCGAGATTATTTGGACTACAAGACCCAATCAGATTATAGAGCAAGATTTGATAAGTACTAGTCAACAAATTGGAATTCATTTAGTGGAAGGATATGCCTGGTAG
>Glyma19g23640.1 sequence type=predicted peptide gene model=Glyma19g23640 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MNGSKYYQDFRLWTVGDGITLMVCTSIFVSLITTILDTSWREIIWTTRPNQIIEQDLISTSQQIGIHLVEGYAW*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||