SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g23501): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g23501): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g23501

Feature Type:gene_model
Chromosome:Gm19
Start:28825398
stop:28825769
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g23501
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G53820AT Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein | chr1:20091491-20092423 FORWARD LENGTH=310 SoyBaseE_val: 2.00E-16ISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR22766Panther RING FINGER PROTEIN 24-RELATED JGI ISS
PTHR22766:SF1Panther gb def: Hypothetical protein T22E16.190 (Hypothetical protein T22E16.19) (At3g55530) JGI ISS
UniRef100_C6T1J3UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T1J3_SOYBN SoyBaseE_val: 9.00E-71ISS
UniRef100_G7L9W7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ring-H2 zinc finger protein-like protein n=1 Tax=Medicago truncatula RepID=G7L9W7_MEDTR SoyBaseE_val: 8.00E-38ISS

Expression Patterns of Glyma19g23501
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g23501 not represented in the dataset
Glyma19g23501 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g23501 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g080200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g23501
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g23501
>Glyma19g23501.1   sequence type=CDS   gene model=Glyma19g23501   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCCAGAGTGTGCACAAAATTTATAAGCATTATGGATATGCCACTGAAGTGAAGGACAATGAAGAGCATGAGGATGATTATTGTTTAGTGTGTCTAAGCCAAATTTGTAAAGGGGAAAAGGCTAGGTCTCTTCCACTGTGCAATTACAGATATCATACTGATTGTATTGGTGCTTGGTTGAAGAATCATACCACTTGCCCCCTTTGTAGGAACAAAATCGCTAACCATATCCCCCAAAATCAAAAACAAGTGAAGAGCTTAGGAGAATCTTTGTTCAATCTCATTCAGAGTTTCCCTGATCTATTGGTAGCTATTCTCTACATGATGATTCTATTTGGCATCACTGAGAGTTTCCCTTTGGTTCATTGA
Predicted protein sequences of Glyma19g23501
>Glyma19g23501.1   sequence type=predicted peptide   gene model=Glyma19g23501   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIQSVHKIYKHYGYATEVKDNEEHEDDYCLVCLSQICKGEKARSLPLCNYRYHTDCIGAWLKNHTTCPLCRNKIANHIPQNQKQVKSLGESLFNLIQSFPDLLVAILYMMILFGITESFPLVH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo