SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g23475

Feature Type:gene_model
Chromosome:Gm19
Start:28809593
stop:28810082
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g23475
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G27160AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S21 family protein | chr3:10017531-10018854 FORWARD LENGTH=183 SoyBaseE_val: 5.00E-20ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PF01165PFAM Ribosomal protein S21 JGI ISS
UniRef100_G7JMN6UniRef Annotation by Michelle Graham. Most informative UniRef hit: 30S ribosomal protein S21 n=1 Tax=Medicago truncatula RepID=G7JMN6_MEDTR SoyBaseE_val: 3.00E-24ISS
UniRef100_I1N7I0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N7I0_SOYBN SoyBaseE_val: 2.00E-61ISS

Expression Patterns of Glyma19g23475
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g23475 not represented in the dataset
Glyma19g23475 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g23475 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g080000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g23475
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g23475
>Glyma19g23475.1   sequence type=CDS   gene model=Glyma19g23475   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGGGCAAGGATGAGCCCGAGGACAAAATCATCAACCGCTTTAAGAAGGAGGTCCTCAAAGCCAGTGTGCTTCAGGAGTGCAAACACACAAGGTTCTTTGAGAACAAACACGACAAGATCAAGAGGAAGGCCCACGAAGCTTCTAGAAGGAACCGAAAAAGGAAGCCACAATCAAGAGCTTGGGCAAAAAATAAACATGGTTCTATAAAGAAGAAAAAGGATGCTGCTAATGATGATATTGATGATTGGGAACTTCCACATGTAGATATTCCATACACTTGA
Predicted protein sequences of Glyma19g23475
>Glyma19g23475.1   sequence type=predicted peptide   gene model=Glyma19g23475   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVGKDEPEDKIINRFKKEVLKASVLQECKHTRFFENKHDKIKRKAHEASRRNRKRKPQSRAWAKNKHGSIKKKKDAANDDIDDWELPHVDIPYT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo