SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g22900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g22900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g22900

Feature Type:gene_model
Chromosome:Gm19
Start:28254004
stop:28256092
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G01660AT Annotation by Michelle Graham. TAIR10: S-adenosyl-L-methionine-dependent methyltransferases superfamily protein | chr3:245532-246432 FORWARD LENGTH=273 SoyBaseE_val: 3.00E-121ISS
GO:0000023GO-bp Annotation by Michelle Graham. GO Biological Process: maltose metabolic process SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0016556GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA modification SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0008168GO-mf Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity SoyBaseN/AISS
PTHR10108Panther METHYLTRANSFERASE JGI ISS
PTHR10108:SF291Panther METHYLTRANSFERASE JGI ISS
PF08241PFAM Methyltransferase domain JGI ISS
UniRef100_B9SLV0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Methyltransferase, putative n=1 Tax=Ricinus communis RepID=B9SLV0_RICCO SoyBaseE_val: 5.00E-137ISS
UniRef100_I1N7H2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N7H2_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g22900 not represented in the dataset

Glyma19g22900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g079000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g22900.1   sequence type=CDS   gene model=Glyma19g22900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAACCTATCTCAGCACCTCATGTCAGAACTTCAATCAAAATTGTTAGCACATTAAACGAAAGCTACCACACCAATCAACCACCCTTGGCAGGCAAAATAAAACGCCTTGTTCTCACCCAGGAAGGTAGAACAAAGCTCAACATTTACCCAGATAGAGAGTTCTATGCATTTCCACGCTTTGTAAAACATGTAGATGATGGTTTTGTTTCTACACTGACCAATCTTTACAGAGAGAGGTTGAGATCTGACATGGAGATTCTTGACCTCATGAGCTCCTGGGTTAGCCATCTACCAAGTGATGTCAAGTACAAAAAGGTGGTGGGGCATGGGTTGAATGGACAAGAGCTTTCAAAGAATCCAAGGTTGGATTTTTTTGTTGTGAAGGATCTCAACAAGGATCAACAGTTTGAATTTGAGAGTTGCAGTTTTGATGCAGTGTTATGCACAGTTAGCGTGCAGTATCTCCAACAACCAGAGAAGGTATTTGAAGAGGTGTTCCGGGTACTAAAGCCAGGAGGGGCATTCATTGTGAGTTTTAGCAACAGAATGTTCTATGAGAAAGCCATAAGTGCATGGAGGGAAGGGACTGCTTATAGTAGGGTACAACTTGTGGTTCAGTACTTCCAATCCGTGGAAGGTTTCACAGAGCCAGAGGTAGTTCGAAAGCTGCCAAATGCTCAAGAGAACAACATGTCACCAATTGGTTGGATCATGAGGCTTTTTGGATTGCTTTCAGGGTCAGATCCCTTCTATGCAGTGATTGCTTACAGGAATTATAAGCCCATACATGATGCCTGA

>Glyma19g22900.1   sequence type=predicted peptide   gene model=Glyma19g22900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQPISAPHVRTSIKIVSTLNESYHTNQPPLAGKIKRLVLTQEGRTKLNIYPDREFYAFPRFVKHVDDGFVSTLTNLYRERLRSDMEILDLMSSWVSHLPSDVKYKKVVGHGLNGQELSKNPRLDFFVVKDLNKDQQFEFESCSFDAVLCTVSVQYLQQPEKVFEEVFRVLKPGGAFIVSFSNRMFYEKAISAWREGTAYSRVQLVVQYFQSVEGFTEPEVVRKLPNAQENNMSPIGWIMRLFGLLSGSDPFYAVIAYRNYKPIHDA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo