SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma19g22871

Feature Type:gene_model
Chromosome:Gm19
Start:28237416
stop:28237967
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G60390AT Annotation by Michelle Graham. TAIR10: GTP binding Elongation factor Tu family protein | chr5:24289226-24290675 FORWARD LENGTH=449 SoyBaseE_val: 3.00E-90ISS
GO:0006414GO-bp Annotation by Michelle Graham. GO Biological Process: translational elongation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0003746GO-mf Annotation by Michelle Graham. GO Molecular Function: translation elongation factor activity SoyBaseN/AISS
GO:0003924GO-mf Annotation by Michelle Graham. GO Molecular Function: GTPase activity SoyBaseN/AISS
GO:0005516GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin binding SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
PTHR23115Panther TRANSLATION FACTOR JGI ISS
PTHR23115:SF57Panther SUBFAMILY NOT NAMED JGI ISS
PF03143PFAM Elongation factor Tu C-terminal domain JGI ISS
PF03144PFAM Elongation factor Tu domain 2 JGI ISS
UniRef100_Q9FYV3UniRef Annotation by Michelle Graham. Best UniRef hit: Elongation factor 1-alpha n=1 Tax=Saccharum officinarum RepID=Q9FYV3_SACOF SoyBaseE_val: 1.00E-84ISS
UniRef100_Q9FYV3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Elongation factor 1-alpha n=1 Tax=Saccharum officinarum RepID=Q9FYV3_SACOF SoyBaseE_val: 1.00E-84ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g22871 not represented in the dataset

Glyma19g22871 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g078900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g22871.1   sequence type=CDS   gene model=Glyma19g22871   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGGTGACTTTTGCTCCCACTGGCCTAACTACTGAAGTTAAGTTTGTGGAGATGCACCATGAAGCTCTCCAGGAGGCCCTTCCAGGTGACAATGTAGGATTTAATGTGAAGAATGTTGCAGTCAAGGATCTCAAGCGTGGTTTTGTTGCCTCAAACTCTAAGGATGATCCTGCCAAGGAGGCTGCCAACTTCACATCCCAATTTGCCGAACTTGTGACCAAGATTGACAGGCGATCAGGTAAGGAAATTGAGAAGGAACCCAAATTCTTGAAAAATGGAGATGCAGGTTATGTTAAGATGATTCCCACCAAGCCCATGGTGGTCGAAACTTTTTCCGAGTATCCTCCTCTTGGTCGTTTTTCCGTGAGGGACATGCGTCAAACTGTGGCTGTAGGAGTCATCAAGAGTGTGGAGAAGAAGGACCCCACCGGAGCCAAGGTCACCAAGGCTGCAGAGAAGAAGTGA

>Glyma19g22871.1   sequence type=predicted peptide   gene model=Glyma19g22871   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVVTFAPTGLTTEVKFVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFSVRDMRQTVAVGVIKSVEKKDPTGAKVTKAAEKK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo