|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G07060 | AT | Annotation by Michelle Graham. TAIR10: NHL domain-containing protein | chr3:2232760-2236913 FORWARD LENGTH=774 | SoyBase | E_val: 2.00E-19 | ISS |
GO:0006346 | GO-bp | Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing | SoyBase | N/A | ISS |
GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
GO:0031048 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin silencing by small RNA | SoyBase | N/A | ISS |
GO:0051567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
UniRef100_G7JVP3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: NHL repeat-containing protein n=1 Tax=Medicago truncatula RepID=G7JVP3_MEDTR | SoyBase | E_val: 3.00E-46 | ISS |
UniRef100_I1N8L4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N8L4_SOYBN | SoyBase | E_val: 2.00E-81 | ISS |
Glyma19g22831 not represented in the dataset |
Glyma19g22831 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g22831.1 sequence type=CDS gene model=Glyma19g22831 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAACGAGGTTTCCTTAAACAAGAGTGGCCTTGCACAACAGTGGTATGATGAATTAGATGATCTTGCTGCTCCAGAACCTGAATCTAAAATAAATGTTCAAGATGATAATCTGGATAAAAAATTGGTAGTGGAAGATGAGAAAGTTCCCTTTAGCGTTGGAGTCTTTACTAGCCCTAGAACAAGTGAGGTTATAATTTATGCTGCACTGTATAGTAAACTTAGAAGTGTCCCAAAGTCAAATGAAGGCAACCGGGAGGAACATGCAGCAAGGATTCTTGATATTTTGAGCTCCAAGAGATCTGGGAAAATAGAGAGAGATTTATGGAAAGCATTTTTATTGCAATCTAAGGATGATTTGAGAGATCTTATTTTCATGAAACCACTACACATTAGACTAAGATTAAGTTGTTAG
>Glyma19g22831.1 sequence type=predicted peptide gene model=Glyma19g22831 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MNEVSLNKSGLAQQWYDELDDLAAPEPESKINVQDDNLDKKLVVEDEKVPFSVGVFTSPRTSEVIIYAALYSKLRSVPKSNEGNREEHAARILDILSSKRSGKIERDLWKAFLLQSKDDLRDLIFMKPLHIRLRLSC*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||