Glyma19g22831 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g22831

Feature Type:	gene_model
Chromosome:	Gm19
Start:	28105160
stop:	28128357
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g22831

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G07060	AT	Annotation by Michelle Graham. TAIR10: NHL domain-containing protein \| chr3:2232760-2236913 FORWARD LENGTH=774	SoyBase	E_val: 2.00E-19	ISS
GO:0006346	GO-bp	Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0031048	GO-bp	Annotation by Michelle Graham. GO Biological Process: chromatin silencing by small RNA	SoyBase	N/A	ISS
GO:0051567	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_G7JVP3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NHL repeat-containing protein n=1 Tax=Medicago truncatula RepID=G7JVP3_MEDTR	SoyBase	E_val: 3.00E-46	ISS
UniRef100_I1N8L4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N8L4_SOYBN	SoyBase	E_val: 2.00E-81	ISS

Expression Patterns of Glyma19g22831

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g22831 not represented in the dataset	Glyma19g22831 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g22831 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma19g22831

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g22831

Limit To All Plant Sequences

>Glyma19g22831.1   sequence type=CDS   gene model=Glyma19g22831   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACGAGGTTTCCTTAAACAAGAGTGGCCTTGCACAACAGTGGTATGATGAATTAGATGATCTTGCTGCTCCAGAACCTGAATCTAAAATAAATGTTCAAGATGATAATCTGGATAAAAAATTGGTAGTGGAAGATGAGAAAGTTCCCTTTAGCGTTGGAGTCTTTACTAGCCCTAGAACAAGTGAGGTTATAATTTATGCTGCACTGTATAGTAAACTTAGAAGTGTCCCAAAGTCAAATGAAGGCAACCGGGAGGAACATGCAGCAAGGATTCTTGATATTTTGAGCTCCAAGAGATCTGGGAAAATAGAGAGAGATTTATGGAAAGCATTTTTATTGCAATCTAAGGATGATTTGAGAGATCTTATTTTCATGAAACCACTACACATTAGACTAAGATTAAGTTGTTAG

Predicted protein sequences of Glyma19g22831

Limit To All Plant Sequences

>Glyma19g22831.1   sequence type=predicted peptide   gene model=Glyma19g22831   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNEVSLNKSGLAQQWYDELDDLAAPEPESKINVQDDNLDKKLVVEDEKVPFSVGVFTSPRTSEVIIYAALYSKLRSVPKSNEGNREEHAARILDILSSKRSGKIERDLWKAFLLQSKDDLRDLIFMKPLHIRLRLSC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain