|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| ATMG00900 | AT | Annotation by Michelle Graham. TAIR10: cytochrome C biogenesis 256 | chrM:239988-240758 REVERSE LENGTH=256 | SoyBase | E_val: 3.00E-44 | ISS |
| GO:0008535 | GO-bp | Annotation by Michelle Graham. GO Biological Process: respiratory chain complex IV assembly | SoyBase | N/A | ISS |
| GO:0015886 | GO-bp | Annotation by Michelle Graham. GO Biological Process: heme transport | SoyBase | N/A | ISS |
| GO:0017004 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cytochrome complex assembly | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0015232 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: heme transporter activity | SoyBase | N/A | ISS |
| PF01578 | PFAM | Cytochrome C assembly protein | JGI | ISS | |
| UniRef100_E9KZM9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome c biogenesis C n=1 Tax=Vigna radiata RepID=E9KZM9_VIGRA | SoyBase | E_val: 4.00E-44 | ISS |
| UniRef100_E9KZM9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Cytochrome c biogenesis C n=1 Tax=Vigna radiata RepID=E9KZM9_VIGRA | SoyBase | E_val: 4.00E-44 | ISS |
|
Glyma19g22380 not represented in the dataset |
Glyma19g22380 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.19g075000 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g22380.1 sequence type=CDS gene model=Glyma19g22380 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTGGGGCACCTTTTGGGTGTGGGATGCTCGTTTAACCTCTGTATTCATCTCGTTTCTGATTTACCTGGGTGCACTGCGTTTTCAAAAGCTTCCTGTCGAACCGGCTCCTATTTCAATCCGTGCTGGACCGATCGATATACCAATAATCAAGTCTTCAGTCAACTGGTGGAATACATTACATCAACCTGGGAGCATTAGCCGATCTGGTACATCAATCTTAAAGTGCTAA
>Glyma19g22380.1 sequence type=predicted peptide gene model=Glyma19g22380 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MWGTFWVWDARLTSVFISFLIYLGALRFQKLPVEPAPISIRAGPIDIPIIKSSVNWWNTLHQPGSISRSGTSILKC*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||