Glyma19g22380 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g22380): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g22380): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g22380

Feature Type:	gene_model
Chromosome:	Gm19
Start:	27051464
stop:	27051709
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g22380

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATMG00900	AT	Annotation by Michelle Graham. TAIR10: cytochrome C biogenesis 256 \| chrM:239988-240758 REVERSE LENGTH=256	SoyBase	E_val: 3.00E-44	ISS
GO:0008535	GO-bp	Annotation by Michelle Graham. GO Biological Process: respiratory chain complex IV assembly	SoyBase	N/A	ISS
GO:0015886	GO-bp	Annotation by Michelle Graham. GO Biological Process: heme transport	SoyBase	N/A	ISS
GO:0017004	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytochrome complex assembly	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0015232	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme transporter activity	SoyBase	N/A	ISS
PF01578	PFAM	Cytochrome C assembly protein	JGI		ISS
UniRef100_E9KZM9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome c biogenesis C n=1 Tax=Vigna radiata RepID=E9KZM9_VIGRA	SoyBase	E_val: 4.00E-44	ISS
UniRef100_E9KZM9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Cytochrome c biogenesis C n=1 Tax=Vigna radiata RepID=E9KZM9_VIGRA	SoyBase	E_val: 4.00E-44	ISS

Expression Patterns of Glyma19g22380

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g22380 not represented in the dataset	Glyma19g22380 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g22380 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g075000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g22380

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g22380

Limit To All Plant Sequences

>Glyma19g22380.1   sequence type=CDS   gene model=Glyma19g22380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGGGGCACCTTTTGGGTGTGGGATGCTCGTTTAACCTCTGTATTCATCTCGTTTCTGATTTACCTGGGTGCACTGCGTTTTCAAAAGCTTCCTGTCGAACCGGCTCCTATTTCAATCCGTGCTGGACCGATCGATATACCAATAATCAAGTCTTCAGTCAACTGGTGGAATACATTACATCAACCTGGGAGCATTAGCCGATCTGGTACATCAATCTTAAAGTGCTAA

Predicted protein sequences of Glyma19g22380

Limit To All Plant Sequences

>Glyma19g22380.1   sequence type=predicted peptide   gene model=Glyma19g22380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MWGTFWVWDARLTSVFISFLIYLGALRFQKLPVEPAPISIRAGPIDIPIIKSSVNWWNTLHQPGSISRSGTSILKC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain