SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g22345

Feature Type:gene_model
Chromosome:Gm19
Start:26970771
stop:26971839
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g22345
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G39200AT Annotation by Michelle Graham. TAIR10: Seven transmembrane MLO family protein | chr2:16356255-16359797 REVERSE LENGTH=576 SoyBaseE_val: 1.00E-24ISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006857GO-bp Annotation by Michelle Graham. GO Biological Process: oligopeptide transport SoyBaseN/AISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0008219GO-bp Annotation by Michelle Graham. GO Biological Process: cell death SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009817GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction SoyBaseN/AISS
GO:0010150GO-bp Annotation by Michelle Graham. GO Biological Process: leaf senescence SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0015824GO-bp Annotation by Michelle Graham. GO Biological Process: proline transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005516GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin binding SoyBaseN/AISS
PF03094PFAM Mlo family JGI ISS
UniRef100_I1MNL9UniRef Annotation by Michelle Graham. Most informative UniRef hit: MLO-like protein n=1 Tax=Glycine max RepID=I1MNL9_SOYBN SoyBaseE_val: 4.00E-53ISS
UniRef100_UPI000233F4BAUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F4BA related cluster n=1 Tax=unknown RepID=UPI000233F4BA SoyBaseE_val: 2.00E-53ISS

Expression Patterns of Glyma19g22345
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g22345 not represented in the dataset
Glyma19g22345 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g22345 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g074700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g22345
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g22345
>Glyma19g22345.1   sequence type=CDS   gene model=Glyma19g22345   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGACCTTGCCATTGTTTCAAAGGGACAGAAACACAAAAGTGCTCTTTATGAATCATTGGAAAAGGTTAACGGAGAGCTTATGATGCTAGGATTCATATCCATGCTACTAGTTGTATTCCAAGGTCCACTTTCTAAGATCTGCATATCACAGAATGTTGCATCCATGTGGCATCCTTGCTCCAACCCCAAGAAGGCCTTAAGTAAATCTGATGGAAAATCGGACAGTGATACCAATGGTAGGAAACTCCTCAAATATTTGGACCCCATACTGTGGTGTGTTCTACTAGCAAAAGGATATGACAAATGTGCTGACAAGGAAAGTTGGAAACTTTTTCATTAA
Predicted protein sequences of Glyma19g22345
>Glyma19g22345.1   sequence type=predicted peptide   gene model=Glyma19g22345   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKDLAIVSKGQKHKSALYESLEKVNGELMMLGFISMLLVVFQGPLSKICISQNVASMWHPCSNPKKALSKSDGKSDSDTNGRKLLKYLDPILWCVLLAKGYDKCADKESWKLFH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo