SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g22270): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g22270): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g22270

Feature Type:gene_model
Chromosome:Gm19
Start:26865499
stop:26869088
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G01860AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: response to cadmium ion; LOCATED IN: chloroplast; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G27210.1); Has 66 Blast hits to 66 proteins in 13 species: Archae - 0; Bacteria - 0; Metazoa - 5; Fungi - 0; Plants - 61; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:302869-304329 FORWARD LENGTH=223 SoyBaseE_val: 2.00E-21ISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009963GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1N7D2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1N7D2_SOYBN SoyBaseE_val: 2.00E-165ISS
UniRef100_Q9SGI5UniRef Annotation by Michelle Graham. Most informative UniRef hit: F28J7.19 protein n=2 Tax=Arabidopsis thaliana RepID=Q9SGI5_ARATH SoyBaseE_val: 1.00E-17ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g22270 not represented in the dataset

Glyma19g22270 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g14870 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g074200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g22270.1   sequence type=CDS   gene model=Glyma19g22270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTTGTGCTCTTCGGTCCCCAGAAACGCTAACGAAGACATGAAGCTCAAACTCTCGTTCGGTTCAAAATCTGAGAAGCTTGTGATTCCTCCAACATCCATCAAGGGACAACAACAACAACAACCCCAAAATGGGTGGTCAACGGCTCGGTCAACGACCACCTTCACTGACCATGGTAGCAAAGAGGAAGCCTTTTTTGATTCCAAGGCCTGGTTAGACTCAGATTGTGAAGATGATTTCTATAGTGTCAATGGTGACTTTACACCATCTAGAGGGACCACACCAGTTCACCACACTTTTGGGACCCCTTCTAGGAATAGAATTCATGGCTCTATGGCTGAAACATCCCCAGAAAAGAAAAAGAAATTGTTAGAGCTTTTTCGCGAAAGTGTCAAAGATGACCAAGGTGATGTTCATGGACACAAAGAAGTCAAGCCAACTATACAAGATGTTATTATGCCTAAATCTGCACATTGCACTCCTTATCTCTCAGAGGCTAACTCTGCCTGTAGTAGTGAAAGGACCATGAGCATGAGCGAGGATCGTTCATCCATTAGAGAGAAATCAGTCAAGTCTTTGCAGTGGTGCATTCCAAGCTTGTCTTCATGCCGAAGCTTTCGCGAGAGGAGGCCAAAGACGAGTCCTGCAGTAGAAGTAAATGGAAAACATTGA

>Glyma19g22270.1   sequence type=predicted peptide   gene model=Glyma19g22270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLCSSVPRNANEDMKLKLSFGSKSEKLVIPPTSIKGQQQQQPQNGWSTARSTTTFTDHGSKEEAFFDSKAWLDSDCEDDFYSVNGDFTPSRGTTPVHHTFGTPSRNRIHGSMAETSPEKKKKLLELFRESVKDDQGDVHGHKEVKPTIQDVIMPKSAHCTPYLSEANSACSSERTMSMSEDRSSIREKSVKSLQWCIPSLSSCRSFRERRPKTSPAVEVNGKH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo