SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g15580): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g15580): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g15580

Feature Type:gene_model
Chromosome:Gm19
Start:18777543
stop:18782049
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g15580
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G41000AT Annotation by Michelle Graham. TAIR10: Chaperone DnaJ-domain superfamily protein | chr2:17111673-17113247 FORWARD LENGTH=184 SoyBaseE_val: 1.00E-48ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0031072GO-mf Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding SoyBaseN/AISS
PTHR24078Panther DNAJ HOMOLOG SUBFAMILY C MEMBER JGI ISS
PF00226PFAM DnaJ domain JGI ISS
UniRef100_G7KPI5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chaperone protein dnaJ n=1 Tax=Medicago truncatula RepID=G7KPI5_MEDTR SoyBaseE_val: 1.00E-55ISS
UniRef100_I1N762UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N762_SOYBN SoyBaseE_val: 4.00E-130ISS

Expression Patterns of Glyma19g15580
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g15580 not represented in the dataset
Glyma19g15580 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g15580 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g064700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g15580
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g15580
>Glyma19g15580.1   sequence type=CDS   gene model=Glyma19g15580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCATTACAAGGTTCTCGGCCTGCACCGAACCGCGACCAAGGAAGAGATCAAAGCGGCGTTCAAGAAGCTAGCGTTCCAGTTCCACCCGGACAAGCATTCGCAATCGCCGAAGGCCGTTCGGGAAAATGCCACACTTCGATTCAAGCAGGTCTCCGAGGCCTACGAGGTTCTGATGGACGATCGCAAGCGCGCCGATTACAATTTCCGGCGGAGCTCCGGCGCCGGCACCGGAAACAACTACTATTCTCAGTATAGCTACGGATACGGTAGGAGTGGGAACAGTTATTATGAGTATAAACCTAGGTCTGGTGGCGGCGGCGGCTTCGCGTCCAAGTTCGAACTCGCGTTTCGGATTTTGACGGCGCGGTCATCGCTTCTCAATCTCGGCTTCGCAGCAGCTATATTAGGTGGGATAGTTGTCATTGATTCAGGTGGAGAATCCTTATGGAGAATGCAAAATTCTGGGAAATCTTTTGAAGAAGCTCTGAAGTCCATTGAGAAGGCCAAACCGTATAAAGAAGATAACATCGAGGAAGATCCTTGA
Predicted protein sequences of Glyma19g15580
>Glyma19g15580.1   sequence type=predicted peptide   gene model=Glyma19g15580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDHYKVLGLHRTATKEEIKAAFKKLAFQFHPDKHSQSPKAVRENATLRFKQVSEAYEVLMDDRKRADYNFRRSSGAGTGNNYYSQYSYGYGRSGNSYYEYKPRSGGGGGFASKFELAFRILTARSSLLNLGFAAAILGGIVVIDSGGESLWRMQNSGKSFEEALKSIEKAKPYKEDNIEEDP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo