SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g15360

Feature Type:gene_model
Chromosome:Gm19
Start:18639206
stop:18639547
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g15360
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G66290AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: N-terminal protein myristoylation; LOCATED IN: cellular_component unknown; EXPRESSED IN: 14 plant structures; EXPRESSED DURING: 7 growth stages; Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). | chr5:26477917-26479441 REVERSE LENGTH=202 SoyBaseE_val: 2.00E-17ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1J8M7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1J8M7_SOYBN SoyBaseE_val: 3.00E-27ISS
UniRef100_Q75GJ4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=2 Tax=Oryza sativa RepID=Q75GJ4_ORYSJ SoyBaseE_val: 1.00E-15ISS

Expression Patterns of Glyma19g15360
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g15360 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma19g15360
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g15360
>Glyma19g15360.1   sequence type=CDS   gene model=Glyma19g15360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGGAAATTGGAGAACTGAAAGGAAGGTTGACTGAAGTTATCAGCAACTGTGATGCTTTGTGCAAGAGGATTGCAACAAAGGGTCCAGAATCTCTCGTGTCATCAATCAAACCTTTTGCAGTTACTACGGCTGATCAAGAAACCTACTTAAGTTCATCTAGTTTGCGGATAGTTTAA
Predicted protein sequences of Glyma19g15360
>Glyma19g15360.1   sequence type=predicted peptide   gene model=Glyma19g15360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVEIGELKGRLTEVISNCDALCKRIATKGPESLVSSIKPFAVTTADQETYLSSSSLRIV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo