Report for Sequence Feature Glyma19g14270
Feature Type: gene_model
Chromosome: Gm19
Start: 17284949
stop: 17288771
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g14270
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G40350 AT
Annotation by Michelle Graham. TAIR10: myb domain protein 24 | chr5:16138703-16140946 REVERSE LENGTH=214
SoyBase E_val: 5.00E-85 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0009740 GO-bp
Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway
SoyBase N/A ISS
GO:0009753 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus
SoyBase N/A ISS
GO:0009867 GO-bp
Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway
SoyBase N/A ISS
GO:0048443 GO-bp
Annotation by Michelle Graham. GO Biological Process: stamen development
SoyBase N/A ISS
GO:0080086 GO-bp
Annotation by Michelle Graham. GO Biological Process: stamen filament development
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
KOG0048
KOG
Transcription factor, Myb superfamily
JGI ISS
PTHR10641 Panther
MYB-RELATED
JGI ISS
PF00249 PFAM
Myb-like DNA-binding domain
JGI ISS
UniRef100_Q0PJJ4 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: MYB transcription factor MYB182 n=1 Tax=Glycine max RepID=Q0PJJ4_SOYBN
SoyBase E_val: 3.00E-153 ISS
UniRef100_Q0PJJ4 UniRef
Annotation by Michelle Graham. Best UniRef hit: MYB transcription factor MYB182 n=1 Tax=Glycine max RepID=Q0PJJ4_SOYBN
SoyBase E_val: 3.00E-153 ISS
Expression Patterns of Glyma19g14270
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma19g14270 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.19g061300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma19g14270
Coding sequences of Glyma19g14270
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g14270.1 sequence type=CDS gene model=Glyma19g14270 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGATAAAAAACAACAGTGTAAGACGTCTCAAGATCCTGAAGTGAGAAAAGGGCCTTGGACAATGGAAGAAGACTTGATCTTGATGAACTATATTGCAAATCATGGGGAAGGTGTTTGGAACTCTTTGGCCAAAGCTGCTGGTCTCAAACGTAACGGAAAGAGTTGCCGGCTAAGGTGGCTAAATTACCTCCGTCCTGATGTTAGAAGAGGGAATATTACACCCGAGGAACAACTTTTGATTATGGAGCTCCACGCAAAGTGGGGAAACAGGTGGTCCAAAATTGCCAAGCATCTACCTGGAAGGACTGATAATGAGATCAAGAACTATTGGAGGACAAGGATCCAGAAGCACATCAAGCAAGCTGAGAACTTTCAGCAACAGAGTAGTAATAATTCTGAGATAAATGATCACCAAGCTAGCACTAGCCATGTTTCCACCATGGCTGAGCCCATGGAGATGTATTCTCCACCCTGTTATCAAGGAATGTTAGAGCCATTTTCAACTCAGTTCCCTACAATTAATCCTGATCAATCCAGTTGTTGTACCAATGACAACAACAACATTAACTATTGGAGCATGGAGGATAGCTGGTCAATGCAATTACTGAACGGTGATTAA
Predicted protein sequences of Glyma19g14270
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g14270.1 sequence type=predicted peptide gene model=Glyma19g14270 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MDKKQQCKTSQDPEVRKGPWTMEEDLILMNYIANHGEGVWNSLAKAAGLKRNGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHIKQAENFQQQSSNNSEINDHQASTSHVSTMAEPMEMYSPPCYQGMLEPFSTQFPTINPDQSSCCTNDNNNINYWSMEDSWSMQLLNGD*