SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g14251): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g14251): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g14251

Feature Type:gene_model
Chromosome:Gm19
Start:17245454
stop:17250592
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G20970AT Annotation by Michelle Graham. TAIR10: NFU domain protein 4 | chr3:7348277-7350069 FORWARD LENGTH=283 SoyBaseE_val: 1.00E-14ISS
GO:0016226GO-bp Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005198GO-mf Annotation by Michelle Graham. GO Molecular Function: structural molecule activity SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0051536GO-mf Annotation by Michelle Graham. GO Molecular Function: iron-sulfur cluster binding SoyBaseN/AISS
PTHR11178Panther IRON-SULFUR CLUSTER SCAFFOLD PROTEIN NFU-RELATED JGI ISS
PF08712PFAM Scaffold protein Nfu/NifU N terminal JGI ISS
UniRef100_B9SG71UniRef Annotation by Michelle Graham. Most informative UniRef hit: HIRA-interacting protein, putative n=1 Tax=Ricinus communis RepID=B9SG71_RICCO SoyBaseE_val: 9.00E-13ISS
UniRef100_I1NJ75UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NJ75_SOYBN SoyBaseE_val: 1.00E-14ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g14251 not represented in the dataset

Glyma19g14251 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g061400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g14251.1   sequence type=CDS   gene model=Glyma19g14251   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCATCCAAACGCAACCCACGCCAAATCCCTCGTCTCTCATGTTTTATCCCGGAAAGCCTGTCATGGAAATTGGAAGTTCCGCCGTCAATTCTTCCCTTGCTAAATCGCTCTTCGCAGTCAACAGTCTCTTTCTTTTCTTCTCTTTTCATCTTGTGTTTATGGATTCCTCTATGCTTATTGTCATTGTGCAAGCATTACTCGCATTTTCTTTGGATCCAATTTCATTACTATTACCAAATCCGAAGAGGCTGAGTGGGAATTCCTCAAGCCAAAAATATTTGTCGCCATTATGGATTTCTACTCCTCCAGTCAAGCTCTCTTTTTAG

>Glyma19g14251.1   sequence type=predicted peptide   gene model=Glyma19g14251   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFIQTQPTPNPSSLMFYPGKPVMEIGSSAVNSSLAKSLFAVNSLFLFFSFHLVFMDSSMLIVIVQALLAFSLDPISLLLPNPKRLSGNSSSQKYLSPLWISTPPVKLSF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo