Glyma19g10272 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g10272): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g10272): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g10272

Feature Type:	gene_model
Chromosome:	Gm19
Start:	12456906
stop:	12459336
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g10272

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G04540	AT	Annotation by Michelle Graham. TAIR10: Beta-ketoacyl synthase \| chr2:1581521-1584635 REVERSE LENGTH=461	SoyBase	E_val: 6.00E-89	ISS
GO:0000038	GO-bp	Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid metabolic process	SoyBase	N/A	ISS
GO:0006633	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009058	GO-bp	Annotation by Michelle Graham. GO Biological Process: biosynthetic process	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0042335	GO-bp	Annotation by Michelle Graham. GO Biological Process: cuticle development	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004312	GO-mf	Annotation by Michelle Graham. GO Molecular Function: fatty acid synthase activity	SoyBase	N/A	ISS
GO:0016747	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups	SoyBase	N/A	ISS
PTHR11712	Panther	POLYKETIDE SYNTHASE-RELATED	JGI		ISS
PTHR11712:SF23	Panther	gb def: 3-oxoacyl-(acyl-carrier-protein) synthase ii [bacillus halodurans]	JGI		ISS
PF00109	PFAM	Beta-ketoacyl synthase, N-terminal domain	JGI		ISS
PF02801	PFAM	Beta-ketoacyl synthase, C-terminal domain	JGI		ISS
UniRef100_I1L8I1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 3-oxoacyl-[acyl-carrier-protein] synthase n=1 Tax=Glycine max RepID=I1L8I1_SOYBN	SoyBase	E_val: 1.00E-108	ISS
UniRef100_UPI000233E787	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E787 related cluster n=1 Tax=unknown RepID=UPI000233E787	SoyBase	E_val: 9.00E-135	ISS

Expression Patterns of Glyma19g10272

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g10272 not represented in the dataset	Glyma19g10272 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g10272 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g061000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g10272

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g10272

Limit To All Plant Sequences

>Glyma19g10272.1   sequence type=CDS   gene model=Glyma19g10272   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCTTTGTAATCATTAATAATCCCGAGCATGGACCGAATCACGCTGCAGTCCCTGCCTGCGCCATTGGTTCACATTCTATTGGTGATGCAGATGTTATGGTAAATGGAGGCACAGGGTCCAACATTGATGCATTATCAATTGCAGGATTCCGCAGGTCTCGATCTTTGACCATAAAATATAATTCAAGCCCACAGGAAGCATCACGGCCATTTGATAGTGGTCGAGATGGGTTTGTGATAGGTGAAGGTTCTAGAGTCTTGGTCTTGGAGGAATTTGAGCATGCAAAAAACCGAGGAGCCAAAATCTATGCAGAGGTCCGTGGCTATGGGATGCCAGGTGATGCATATCATATTACTCAACCTCCTAGTGATGGGAGAGGAGCCATTTTGGCCATGACTCGTGCTTTAAGACAGCAATTTTTTCAAGGTGCTATTGGTCATCTCCTAGGCGCTGCTGGAGCTGTTGAAGCAATTTTTGCAGTTTTGGCAATACGGCATGGTATTGCTCCATTAACTCTTAATTTAACTAAGCCAAATCCTATGTTCGGTGATGGTTTCATGCCATTGTCTGCTTTAGAAGAAATGCCAATTAGAGTTGCTATGTCACAAAGTGTGCTTAATTTTAATGCTACTATCTTCTATGCGAGTAATATGAGCGATTTTATTTTCTGCAGGGGAAAATAA

Predicted protein sequences of Glyma19g10272

Limit To All Plant Sequences

>Glyma19g10272.1   sequence type=predicted peptide   gene model=Glyma19g10272   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIFVIINNPEHGPNHAAVPACAIGSHSIGDADVMVNGGTGSNIDALSIAGFRRSRSLTIKYNSSPQEASRPFDSGRDGFVIGEGSRVLVLEEFEHAKNRGAKIYAEVRGYGMPGDAYHITQPPSDGRGAILAMTRALRQQFFQGAIGHLLGAAGAVEAIFAVLAIRHGIAPLTLNLTKPNPMFGDGFMPLSALEEMPIRVAMSQSVLNFNATIFYASNMSDFIFCRGK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain