|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G37020 | AT | Annotation by Michelle Graham. TAIR10: auxin response factor 8 | chr5:14630151-14633916 FORWARD LENGTH=773 | SoyBase | E_val: 1.00E-38 | ISS |
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0009725 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to hormone stimulus | SoyBase | N/A | ISS |
| GO:0009733 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus | SoyBase | N/A | ISS |
| GO:0009855 | GO-bp | Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry | SoyBase | N/A | ISS |
| GO:0009886 | GO-bp | Annotation by Michelle Graham. GO Biological Process: post-embryonic morphogenesis | SoyBase | N/A | ISS |
| GO:0009887 | GO-bp | Annotation by Michelle Graham. GO Biological Process: organ morphogenesis | SoyBase | N/A | ISS |
| GO:0009908 | GO-bp | Annotation by Michelle Graham. GO Biological Process: flower development | SoyBase | N/A | ISS |
| GO:0009909 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of flower development | SoyBase | N/A | ISS |
| GO:0010051 | GO-bp | Annotation by Michelle Graham. GO Biological Process: xylem and phloem pattern formation | SoyBase | N/A | ISS |
| GO:0010154 | GO-bp | Annotation by Michelle Graham. GO Biological Process: fruit development | SoyBase | N/A | ISS |
| GO:0048439 | GO-bp | Annotation by Michelle Graham. GO Biological Process: flower morphogenesis | SoyBase | N/A | ISS |
| GO:0048481 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ovule development | SoyBase | N/A | ISS |
| GO:0048507 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem development | SoyBase | N/A | ISS |
| GO:0048519 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of biological process | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
| GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS |
| GO:0046983 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity | SoyBase | N/A | ISS |
| UniRef100_G7KFN6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Auxin response factor n=1 Tax=Medicago truncatula RepID=G7KFN6_MEDTR | SoyBase | E_val: 2.00E-39 | ISS |
| UniRef100_I1MZK6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MZK6_SOYBN | SoyBase | E_val: 1.00E-41 | ISS |
|
Glyma19g09975 not represented in the dataset |
Glyma19g09975 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.19g059600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g09975.1 sequence type=CDS gene model=Glyma19g09975 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAGCTTTCAACATCAGGGTTGGGGCAGCAGGGACATGAAGGAGGGGAGAAGAAGTGTCTGAATTCTGAGCTATGGCATGCATGCACGGGCCCCTTGGTGTCCCTACCAACTGCAGGGACTCATGTGGTTTACTTCCCTCAAGGTCATAATGAGCAGGTTGCTGCCACAACTAACAGAGAAATTGATGGACACATTCCCAATTACCCTAGCTTGCCACCCTAG
>Glyma19g09975.1 sequence type=predicted peptide gene model=Glyma19g09975 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKLSTSGLGQQGHEGGEKKCLNSELWHACTGPLVSLPTAGTHVVYFPQGHNEQVAATTNREIDGHIPNYPSLPP*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||