Glyma19g09080 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g09080): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g09080): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g09080

Feature Type:	gene_model
Chromosome:	Gm19
Start:	10706521
stop:	10707037
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g09080

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G09795	AT	Annotation by Michelle Graham. TAIR10: ATP phosphoribosyl transferase 2 \| chr1:3173588-3176690 FORWARD LENGTH=413	SoyBase	E_val: 1.00E-16	ISS
GO:0000023	GO-bp	Annotation by Michelle Graham. GO Biological Process: maltose metabolic process	SoyBase	N/A	ISS
GO:0000105	GO-bp	Annotation by Michelle Graham. GO Biological Process: histidine biosynthetic process	SoyBase	N/A	ISS
GO:0006567	GO-bp	Annotation by Michelle Graham. GO Biological Process: threonine catabolic process	SoyBase	N/A	ISS
GO:0019252	GO-bp	Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0000287	GO-mf	Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding	SoyBase	N/A	ISS
GO:0003879	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP phosphoribosyltransferase activity	SoyBase	N/A	ISS
PF01634	PFAM	ATP phosphoribosyltransferase	JGI		ISS
UniRef100_G7INM2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ATP phosphoribosyltransferase n=1 Tax=Medicago truncatula RepID=G7INM2_MEDTR	SoyBase	E_val: 4.00E-17	ISS
UniRef100_UPI000233E288	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E288 related cluster n=1 Tax=unknown RepID=UPI000233E288	SoyBase	E_val: 2.00E-20	ISS

Expression Patterns of Glyma19g09080

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g09080 not represented in the dataset	Glyma19g09080 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g09080 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma19g09080

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g09080

Limit To All Plant Sequences

>Glyma19g09080.1   sequence type=CDS   gene model=Glyma19g09080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGATAGTTGATGCTATGTTGGACATTGTAAGTAGTGGGACCACACTGATAGAAAACAACTTGAAGGAAATCAAAGGTGGAGATGTTTTGGAAAGCCAGATTATCAATTTTTATATTTCCCAATCCCCCCCTTACTCCACCAGGGTTACTGCAAACATGAGGGGAAGCAGTGCAGAGGAAGTGGCCGAGAGAATATTGAGTCAACCATCATTAATG

Predicted protein sequences of Glyma19g09080

Limit To All Plant Sequences

>Glyma19g09080.1   sequence type=predicted peptide   gene model=Glyma19g09080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGIVDAMLDIVSSGTTLIENNLKEIKGGDVLESQIINFYISQSPPYSTRVTANMRGSSAEEVAERILSQPSLM

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain