SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g08990

Feature Type:gene_model
Chromosome:Gm19
Start:10507747
stop:10508458
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g08990
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G51510AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast thylakoid membrane, chloroplast; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; Has 42 Blast hits to 42 proteins in 19 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 40; Viruses - 0; Other Eukaryotes - 2 (source: NCBI BLink). | chr3:19109118-19109842 FORWARD LENGTH=181 SoyBaseE_val: 1.00E-36ISS
GO:0000023GO-bp Annotation by Michelle Graham. GO Biological Process: maltose metabolic process SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0043085GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1N6Z8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N6Z8_SOYBN SoyBaseE_val: 2.00E-79ISS
UniRef100_Q9SCZ8UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT3g51510/F26O13_150 n=1 Tax=Arabidopsis thaliana RepID=Q9SCZ8_ARATH SoyBaseE_val: 5.00E-34ISS

Expression Patterns of Glyma19g08990
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g08990 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g057100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g08990
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g08990
>Glyma19g08990.2   sequence type=CDS   gene model=Glyma19g08990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGTGCAGTGCAAAATCAACATGTATCACACCCTACAGCATTTTTGGGAGTTCCTAAGAACAATCAGAGAAAAATGAAAACACCGCACAGGTTAGTTGTGGTTGCGGTGACTCAAGGCTCTACTGAATCAAGCAAGTCCGATGAAAAAATCCCTTCGTGGGCCAAACCGAACTTCGATGAACCACCGCCATGGGCCCAGGACGAGCCCAACAACAACAGTTCACAACAAGAAGGATTTGAGATCCCGTTCTATGCTTATTTGCTTGCCTCTGCTATCACTGCAATTGCCACTATAGGTTCCCTTTTCGAATATGTATATCAAAAGCCTATTTTCGGAGTATTAAGCTTTGACAGCCTGTTTTATGCTCCCTTGCTTGGTTTTTTTGTCTTCACCGACATTCCCTCATCGGAAGCAGAGGAACAAGATAAGAGGGATGACTATTTATAG
Predicted protein sequences of Glyma19g08990
>Glyma19g08990.2   sequence type=predicted peptide   gene model=Glyma19g08990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GAVQNQHVSHPTAFLGVPKNNQRKMKTPHRLVVVAVTQGSTESSKSDEKIPSWAKPNFDEPPPWAQDEPNNNSSQQEGFEIPFYAYLLASAITAIATIGSLFEYVYQKPIFGVLSFDSLFYAPLLGFFVFTDIPSSEAEEQDKRDDYL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo