Glyma19g08955 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g08955): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g08955): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g08955

Feature Type:	gene_model
Chromosome:	Gm19
Start:	10466748
stop:	10468387
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g08955

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G23570	AT	Annotation by Michelle Graham. TAIR10: phosphatase-related \| chr4:12300015-12302493 FORWARD LENGTH=350	SoyBase	E_val: 4.00E-14	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0071365	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to auxin stimulus	SoyBase	N/A	ISS
GO:2000072	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of defense response to fungus, incompatible interaction	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0019005	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: SCF ubiquitin ligase complex	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PF05002	PFAM	SGS domain	JGI		ISS
UniRef100_B6EBD5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: SGT1-2 n=1 Tax=Glycine max RepID=B6EBD5_SOYBN	SoyBase	E_val: 5.00E-12	ISS
UniRef100_I1MPF6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MPF6_SOYBN	SoyBase	E_val: 4.00E-12	ISS

Expression Patterns of Glyma19g08955

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g08955 not represented in the dataset	Glyma19g08955 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g08955 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g057000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g08955

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g08955

Limit To All Plant Sequences

>Glyma19g08955.1   sequence type=CDS   gene model=Glyma19g08955   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATTTGGCAGTTGCAAGAGGTTGGTACACGTGGTTCCCCTGCCCTAACACTTCATTTCAGGAGAAAGAAGAAAAACTTGATGGTGATGCTGCGTTGAACAAATTTTTTTGTGAAATATATCAAGATGCAAATGAGGACACAAGAAGAGCAATGAGCAAATCATTTGGTTTAGGGTTGACTTCGGCGGGGCGGCACGGCCACGATGTCACTGATCGCTGA

Predicted protein sequences of Glyma19g08955

Limit To All Plant Sequences

>Glyma19g08955.1   sequence type=predicted peptide   gene model=Glyma19g08955   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNLAVARGWYTWFPCPNTSFQEKEEKLDGDAALNKFFCEIYQDANEDTRRAMSKSFGLGLTSAGRHGHDVTDR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain