|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G23570 | AT | Annotation by Michelle Graham. TAIR10: phosphatase-related | chr4:12300015-12302493 FORWARD LENGTH=350 | SoyBase | E_val: 4.00E-14 | ISS |
| GO:0006511 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process | SoyBase | N/A | ISS |
| GO:0006952 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response | SoyBase | N/A | ISS |
| GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
| GO:0071365 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to auxin stimulus | SoyBase | N/A | ISS |
| GO:2000072 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of defense response to fungus, incompatible interaction | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0019005 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: SCF ubiquitin ligase complex | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| PF05002 | PFAM | SGS domain | JGI | ISS | |
| UniRef100_B6EBD5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: SGT1-2 n=1 Tax=Glycine max RepID=B6EBD5_SOYBN | SoyBase | E_val: 5.00E-12 | ISS |
| UniRef100_I1MPF6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MPF6_SOYBN | SoyBase | E_val: 4.00E-12 | ISS |
|
Glyma19g08955 not represented in the dataset |
Glyma19g08955 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.19g057000 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g08955.1 sequence type=CDS gene model=Glyma19g08955 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAATTTGGCAGTTGCAAGAGGTTGGTACACGTGGTTCCCCTGCCCTAACACTTCATTTCAGGAGAAAGAAGAAAAACTTGATGGTGATGCTGCGTTGAACAAATTTTTTTGTGAAATATATCAAGATGCAAATGAGGACACAAGAAGAGCAATGAGCAAATCATTTGGTTTAGGGTTGACTTCGGCGGGGCGGCACGGCCACGATGTCACTGATCGCTGA
>Glyma19g08955.1 sequence type=predicted peptide gene model=Glyma19g08955 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MNLAVARGWYTWFPCPNTSFQEKEEKLDGDAALNKFFCEIYQDANEDTRRAMSKSFGLGLTSAGRHGHDVTDR*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||