|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G47640 | AT | Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: mitochondrion; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF2053, membrane (InterPro:IPR019164); Has 204 Blast hits to 204 proteins in 84 species: Archae - 0; Bacteria - 0; Metazoa - 127; Fungi - 0; Plants - 50; Viruses - 0; Other Eukaryotes - 27 (source: NCBI BLink). | chr1:17518409-17519998 REVERSE L | SoyBase | E_val: 3.00E-35 | ISS |
GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
PF09767 | PFAM | Predicted membrane protein (DUF2053) | JGI | ISS | |
UniRef100_G7J5Q0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Transmembrane protein n=1 Tax=Medicago truncatula RepID=G7J5Q0_MEDTR | SoyBase | E_val: 2.00E-38 | ISS |
UniRef100_I1JTF5 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JTF5_SOYBN | SoyBase | E_val: 3.00E-52 | ISS |
Glyma19g08385 not represented in the dataset |
Glyma19g08385 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g08385.1 sequence type=CDS gene model=Glyma19g08385 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGAGGGACTCACGGAGTTTTTGAAGGCATTAATAGGCTTTATAGATGTTGTTGGGCTTTATTTTGCCTTGACCCAGTTGACTCACAGGAACATCTCTCAGAATCATAAATTTCAAGCAGTTGGACTGATTTTTGCACTTGCATCTGCACAGTTGTTGAGCATATCCCTTGTTGCACTTGGATCTTTGATGTGGCTTCGAAAAAATAAACCCAAGACCCTCATCCCTATTATATATTTGAGTGCAGGGATTGTAGCAACTATGCCATCTATCACAAGGTCTTTCCTGGTTCATTACAATTACTGTTATGATTATATGTAA
>Glyma19g08385.1 sequence type=predicted peptide gene model=Glyma19g08385 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MEGLTEFLKALIGFIDVVGLYFALTQLTHRNISQNHKFQAVGLIFALASAQLLSISLVALGSLMWLRKNKPKTLIPIIYLSAGIVATMPSITRSFLVHYNYCYDYM*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||