SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g08385

Feature Type:gene_model
Chromosome:Gm19
Start:9930551
stop:9931754
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g08385
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G47640AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: mitochondrion; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF2053, membrane (InterPro:IPR019164); Has 204 Blast hits to 204 proteins in 84 species: Archae - 0; Bacteria - 0; Metazoa - 127; Fungi - 0; Plants - 50; Viruses - 0; Other Eukaryotes - 27 (source: NCBI BLink). | chr1:17518409-17519998 REVERSE L SoyBaseE_val: 3.00E-35ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF09767PFAM Predicted membrane protein (DUF2053) JGI ISS
UniRef100_G7J5Q0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transmembrane protein n=1 Tax=Medicago truncatula RepID=G7J5Q0_MEDTR SoyBaseE_val: 2.00E-38ISS
UniRef100_I1JTF5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JTF5_SOYBN SoyBaseE_val: 3.00E-52ISS

Expression Patterns of Glyma19g08385
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g08385 not represented in the dataset
Glyma19g08385 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g08385 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma19g08385
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g08385
>Glyma19g08385.1   sequence type=CDS   gene model=Glyma19g08385   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGGACTCACGGAGTTTTTGAAGGCATTAATAGGCTTTATAGATGTTGTTGGGCTTTATTTTGCCTTGACCCAGTTGACTCACAGGAACATCTCTCAGAATCATAAATTTCAAGCAGTTGGACTGATTTTTGCACTTGCATCTGCACAGTTGTTGAGCATATCCCTTGTTGCACTTGGATCTTTGATGTGGCTTCGAAAAAATAAACCCAAGACCCTCATCCCTATTATATATTTGAGTGCAGGGATTGTAGCAACTATGCCATCTATCACAAGGTCTTTCCTGGTTCATTACAATTACTGTTATGATTATATGTAA
Predicted protein sequences of Glyma19g08385
>Glyma19g08385.1   sequence type=predicted peptide   gene model=Glyma19g08385   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGLTEFLKALIGFIDVVGLYFALTQLTHRNISQNHKFQAVGLIFALASAQLLSISLVALGSLMWLRKNKPKTLIPIIYLSAGIVATMPSITRSFLVHYNYCYDYM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo