Glyma19g07600 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g07600

Feature Type:	gene_model
Chromosome:	Gm19
Start:	9033577
stop:	9035351
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g07600

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G14360	AT	Annotation by Michelle Graham. TAIR10: Ubiquitin-like superfamily protein \| chr5:4631038-4631641 FORWARD LENGTH=163	SoyBase	E_val: 6.00E-52	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR10666	Panther	UBIQUITIN	JGI		ISS
PTHR10666:SF85	Panther		JGI		ISS
PF00240	PFAM	Ubiquitin family	JGI		ISS
UniRef100_B9SLT0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein binding protein, putative n=1 Tax=Ricinus communis RepID=B9SLT0_RICCO	SoyBase	E_val: 2.00E-66	ISS
UniRef100_C6TN95	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TN95_SOYBN	SoyBase	E_val: 2.00E-111	ISS

Expression Patterns of Glyma19g07600

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g07600 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g054400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g07600

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g07600

Limit To All Plant Sequences

>Glyma19g07600.1   sequence type=CDS   gene model=Glyma19g07600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCAGGTTGAGATCAAAGAGGTTTTCAAGAAGCAGCTCCAAGCCTGGAAACAATGGGAGCAAAGCAGCATCATCATCCCCAGAAAAGGATTGCAAAAGTATTGGTGAAATCAAGTGGGAACTTAGGCCTGGTGGCATGCTTGTTCAGAAAAGGGAGAGTAATCAAAGTTCTGGGGAAGGGGTGATCACTATTAGAGTGTCAACTGTGTCACAGTGGCATGACATTAACATTGATGCCACTTCAACTTTTGGGGAATTAAAAATGATTTTGTCACTGGTGACAAGTTTGGAGCCCAGAGAGCAGAGGCTTCTCTTCAGGGGCAAAGAGAAAGAGGACAATGAGTTCCTTCACATGGTTGGGGTTAGGGACAAGGACAAGGTGCTGCTGCTAGAGGATCCAGCAATCAAGGAAATGAAGCTTCTTGGCATGGCAAGAGGCCAACCCATTAACAATACTTGTTGTACCATCAGTGCATGA

Predicted protein sequences of Glyma19g07600

Limit To All Plant Sequences

>Glyma19g07600.1   sequence type=predicted peptide   gene model=Glyma19g07600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIRLRSKRFSRSSSKPGNNGSKAASSSPEKDCKSIGEIKWELRPGGMLVQKRESNQSSGEGVITIRVSTVSQWHDINIDATSTFGELKMILSLVTSLEPREQRLLFRGKEKEDNEFLHMVGVRDKDKVLLLEDPAIKEMKLLGMARGQPINNTCCTISA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain