SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma19g07600

Feature Type:gene_model
Chromosome:Gm19
Start:9033577
stop:9035351
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G14360AT Annotation by Michelle Graham. TAIR10: Ubiquitin-like superfamily protein | chr5:4631038-4631641 FORWARD LENGTH=163 SoyBaseE_val: 6.00E-52ISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR10666Panther UBIQUITIN JGI ISS
PTHR10666:SF85Panther JGI ISS
PF00240PFAM Ubiquitin family JGI ISS
UniRef100_B9SLT0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein binding protein, putative n=1 Tax=Ricinus communis RepID=B9SLT0_RICCO SoyBaseE_val: 2.00E-66ISS
UniRef100_C6TN95UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TN95_SOYBN SoyBaseE_val: 2.00E-111ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g054400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g07600.1   sequence type=CDS   gene model=Glyma19g07600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCAGGTTGAGATCAAAGAGGTTTTCAAGAAGCAGCTCCAAGCCTGGAAACAATGGGAGCAAAGCAGCATCATCATCCCCAGAAAAGGATTGCAAAAGTATTGGTGAAATCAAGTGGGAACTTAGGCCTGGTGGCATGCTTGTTCAGAAAAGGGAGAGTAATCAAAGTTCTGGGGAAGGGGTGATCACTATTAGAGTGTCAACTGTGTCACAGTGGCATGACATTAACATTGATGCCACTTCAACTTTTGGGGAATTAAAAATGATTTTGTCACTGGTGACAAGTTTGGAGCCCAGAGAGCAGAGGCTTCTCTTCAGGGGCAAAGAGAAAGAGGACAATGAGTTCCTTCACATGGTTGGGGTTAGGGACAAGGACAAGGTGCTGCTGCTAGAGGATCCAGCAATCAAGGAAATGAAGCTTCTTGGCATGGCAAGAGGCCAACCCATTAACAATACTTGTTGTACCATCAGTGCATGA

>Glyma19g07600.1   sequence type=predicted peptide   gene model=Glyma19g07600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIRLRSKRFSRSSSKPGNNGSKAASSSPEKDCKSIGEIKWELRPGGMLVQKRESNQSSGEGVITIRVSTVSQWHDINIDATSTFGELKMILSLVTSLEPREQRLLFRGKEKEDNEFLHMVGVRDKDKVLLLEDPAIKEMKLLGMARGQPINNTCCTISA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo