Glyma19g07557 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g07557): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g07557): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g07557

Feature Type:	gene_model
Chromosome:	Gm19
Start:	8991899
stop:	8994277
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g07557

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATCG00150	AT	Annotation by Michelle Graham. TAIR10: ATPase, F0 complex, subunit A protein \| chrC:14021-14770 REVERSE LENGTH=249	SoyBase	E_val: 2.00E-41	ISS
GO:0006091	GO-bp	Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy	SoyBase	N/A	ISS
GO:0006176	GO-bp	Annotation by Michelle Graham. GO Biological Process: dATP biosynthetic process from ADP	SoyBase	N/A	ISS
GO:0006354	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation	SoyBase	N/A	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0015986	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled proton transport	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009544	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast ATP synthase complex	SoyBase	N/A	ISS
GO:0045263	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting ATP synthase complex, coupling factor F(o)	SoyBase	N/A	ISS
GO:0015078	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015252	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrogen ion channel activity	SoyBase	N/A	ISS
PTHR11410	Panther	ATP SYNTHASE SUBUNIT 6	JGI		ISS
PF00119	PFAM	ATP synthase A chain	JGI		ISS
UniRef100_D3WCY6	UniRef	Annotation by Michelle Graham. Best UniRef hit: ATP synthase subunit a, chloroplastic n=1 Tax=Ximenia americana RepID=D3WCY6_XIMAM	SoyBase	E_val: 2.00E-43	ISS
UniRef100_D3WCY6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ATP synthase subunit a, chloroplastic n=1 Tax=Ximenia americana RepID=D3WCY6_XIMAM	SoyBase	E_val: 2.00E-43	ISS

Expression Patterns of Glyma19g07557

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g07557 not represented in the dataset	Glyma19g07557 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g07557 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g054200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g07557

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g07557

Limit To All Plant Sequences

>Glyma19g07557.1   sequence type=CDS   gene model=Glyma19g07557   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAGTCACTAGACGAGGTAGAGAGAGGCCAGGTCACAAACGACTAGCTTATTTTAATAAATACATCCAACCAACCTCAATCCTTTTACCGATTAACATCTTAGAAGATTTCACAAAACCCTTATCTCTTAGTTTTCGACTTTTCAAAAATATATTAGCTGATGAAGTAGTAGTTGTTGTTCTTGTTTCTTTAGTATCTTTAGTAATTCCTATACCTATCATGTTCCTTGGATTATTCACAAGCGGTATTCAAGCTCTCATTTTTGCTACTTTAGATGCGGCTTATATAGGTGAATCCATGGAAGGCCATCATTGA

Predicted protein sequences of Glyma19g07557

Limit To All Plant Sequences

>Glyma19g07557.1   sequence type=predicted peptide   gene model=Glyma19g07557   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSVTRRGRERPGHKRLAYFNKYIQPTSILLPINILEDFTKPLSLSFRLFKNILADEVVVVVLVSLVSLVIPIPIMFLGLFTSGIQALIFATLDAAYIGESMEGHH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain