|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
ATCG00150 | AT | Annotation by Michelle Graham. TAIR10: ATPase, F0 complex, subunit A protein | chrC:14021-14770 REVERSE LENGTH=249 | SoyBase | E_val: 2.00E-41 | ISS |
GO:0006091 | GO-bp | Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy | SoyBase | N/A | ISS |
GO:0006176 | GO-bp | Annotation by Michelle Graham. GO Biological Process: dATP biosynthetic process from ADP | SoyBase | N/A | ISS |
GO:0006354 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation | SoyBase | N/A | ISS |
GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
GO:0015986 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled proton transport | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0009534 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid | SoyBase | N/A | ISS |
GO:0009535 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane | SoyBase | N/A | ISS |
GO:0009544 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast ATP synthase complex | SoyBase | N/A | ISS |
GO:0045263 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting ATP synthase complex, coupling factor F(o) | SoyBase | N/A | ISS |
GO:0015078 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transmembrane transporter activity | SoyBase | N/A | ISS |
GO:0015252 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrogen ion channel activity | SoyBase | N/A | ISS |
PTHR11410 | Panther | ATP SYNTHASE SUBUNIT 6 | JGI | ISS | |
PF00119 | PFAM | ATP synthase A chain | JGI | ISS | |
UniRef100_D3WCY6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: ATP synthase subunit a, chloroplastic n=1 Tax=Ximenia americana RepID=D3WCY6_XIMAM | SoyBase | E_val: 2.00E-43 | ISS |
UniRef100_D3WCY6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: ATP synthase subunit a, chloroplastic n=1 Tax=Ximenia americana RepID=D3WCY6_XIMAM | SoyBase | E_val: 2.00E-43 | ISS |
Glyma19g07557 not represented in the dataset |
Glyma19g07557 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.19g054200 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g07557.1 sequence type=CDS gene model=Glyma19g07557 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTCAGTCACTAGACGAGGTAGAGAGAGGCCAGGTCACAAACGACTAGCTTATTTTAATAAATACATCCAACCAACCTCAATCCTTTTACCGATTAACATCTTAGAAGATTTCACAAAACCCTTATCTCTTAGTTTTCGACTTTTCAAAAATATATTAGCTGATGAAGTAGTAGTTGTTGTTCTTGTTTCTTTAGTATCTTTAGTAATTCCTATACCTATCATGTTCCTTGGATTATTCACAAGCGGTATTCAAGCTCTCATTTTTGCTACTTTAGATGCGGCTTATATAGGTGAATCCATGGAAGGCCATCATTGA
>Glyma19g07557.1 sequence type=predicted peptide gene model=Glyma19g07557 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSVTRRGRERPGHKRLAYFNKYIQPTSILLPINILEDFTKPLSLSFRLFKNILADEVVVVVLVSLVSLVIPIPIMFLGLFTSGIQALIFATLDAAYIGESMEGHH*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||